Leptonychotes weddellii (Weddell seal): 102746847 Help Entry 102746847         CDS       T08708                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04613   Neutrophil extracellular trap formation lww05034   Alcoholism lww05203   Viral carcinogenesis lww05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102746847  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102746847   09163 Immune disease    05322 Systemic lupus erythematosus     102746847   09165 Substance dependence    05034 Alcoholism     102746847  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lww03036]     102746847   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102746847 Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102746847 Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102746847 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  102746847 NCBI-ProteinID:  XP_006750239 UniProt:  A0A2U3Z2M8 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccagcaaagtcggctcctgctcccaagaagggctccaagaaggctgttacg aaagtgcagaagaaggacggtaagaagcgcaagcgcagccgcaaggagagctactctgtt tatgtgtataaggtgttgaagcaggttcatccggacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagctcgaagtaa

DBGET integrated database retrieval system