Leptonychotes weddellii (Weddell seal): 102750662 Help Entry 102750662         CDS       T08708                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04146   Peroxisome lww04213   Longevity regulating pathway - multiple species lww05012   Parkinson disease lww05014   Amyotrophic lateral sclerosis lww05016   Huntington disease lww05020   Prion disease lww05022   Pathways of neurodegeneration - multiple diseases lww05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:lww00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     102750662 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     102750662 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102750662 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     102750662 (SOD1)    05014 Amyotrophic lateral sclerosis     102750662 (SOD1)    05016 Huntington disease     102750662 (SOD1)    05020 Prion disease     102750662 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     102750662 (SOD1) Enzymes [BR:lww01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      102750662 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  102750662 NCBI-ProteinID:  XP_030897234 UniProt:  A0A7F8RWC3 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search LKGNGPVVVSGTITGLTEGEHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDQERHVG DLGNVTAGKDGVATVSLEDSLIALSGDHSIIGRTMVVHEKRDDLGKGGNEESTQTGNAGS RLACGVIGIAK NT seq 396 nt NT seq  +upstreamnt  +downstreamnt ctaaagggaaatgggcctgttgtggtgtcaggaaccattacaggattgactgaaggcgag catggattccacgtccatcaatttggagataatactcaaggctgtaccagtgcaggtcct cactttaatcctctatccaaaaaacacggtgggccaaaagatcaagagaggcatgtcgga gacctgggcaatgtgactgctggcaaggatggtgtggccaccgtgtccttggaagattct ctgatcgcactctcaggagaccattccatcattggccgcacaatggtggtccacgagaaa cgagatgacttgggcaaaggtggcaatgaagaaagtacacagacgggaaacgctgggagt cgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system