Methylococcus capsulatus: MCA2537 Help Entry MCA2537           CDS       T00205                                  Symbol secB Name (GenBank) protein-export protein SecB   KO K03071   preprotein translocase subunit SecB Organism mca  Methylococcus capsulatus Pathway mca02024   Quorum sensing mca03060   Protein export mca03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mca00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MCA2537 (secB)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MCA2537 (secB)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     MCA2537 (secB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mca03110]     MCA2537 (secB)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mca02044]     MCA2537 (secB) Chaperones and folding catalysts [BR:mca03110]  Other chaperones and cochaperones   SecB    MCA2537 (secB) Secretion system [BR:mca02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    MCA2537 (secB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecB Motif Other DBs NCBI-ProteinID:  AAU91409 UniProt:  Q604K2 LinkDB All DBs Position 2712448..2712915 Genome browser AA seq 155 aa AA seqDB search MSEENQQPERQFAIQKLYVKDVSFETPNSPAVFTLKWEPKVEFNLGSKVQQLQEGLFEVS LSVTITVKLEEKTAYLVEICQAGIFTISGFPEQEMGPLLGSYCPNILFPYAREAVSDLVN KGGFPPMLLAPINFDALYMQQVQMAQQQAQPATPH NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagaaaaccagcagcccgaaagacagttcgccatccagaagctctacgtcaag gacgtatcgttcgagacccccaactcgcccgccgtctttactctgaagtgggaaccgaaa gtcgagttcaatctcggctccaaggtccagcagctccaggaaggcctgttcgaagtcagc ctctcagtcacgatcaccgtgaagctggaggagaagacggcctacctggtcgaaatctgc caggccggcattttcacgatcagcggtttcccggaacaggaaatgggacccttgctcggc agctattgccccaacatcctgttcccctatgcccgcgaggcggtctcggatctcgtgaac aaaggcggtttcccgccgatgctgctggcaccgatcaatttcgacgcgctctacatgcag caggttcagatggcccagcagcaggcccagccggccacgccgcactga

DBGET integrated database retrieval system