Mus caroli (Ryukyu mouse): 110285868 Help Entry 110285868         CDS       T05910                                  Name (RefSeq) glutathione S-transferase P 1   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal00480   Glutathione metabolism mcal00980   Metabolism of xenobiotics by cytochrome P450 mcal00982   Drug metabolism - cytochrome P450 mcal00983   Drug metabolism - other enzymes mcal01100   Metabolic pathways mcal01524   Platinum drug resistance mcal05200   Pathways in cancer mcal05204   Chemical carcinogenesis - DNA adducts mcal05215   Prostate cancer mcal05225   Hepatocellular carcinoma mcal05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mcal00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     110285868   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     110285868    00982 Drug metabolism - cytochrome P450     110285868    00983 Drug metabolism - other enzymes     110285868  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110285868    05204 Chemical carcinogenesis - DNA adducts     110285868   09162 Cancer: specific types    05225 Hepatocellular carcinoma     110285868    05215 Prostate cancer     110285868   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110285868   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110285868  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mcal02000]     110285868 Enzymes [BR:mcal01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      110285868 Transporters [BR:mcal02000]  Other transporters   Pores ion channels [TC:1]    110285868 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  110285868 NCBI-ProteinID:  XP_021007987 UniProt:  A0A6P5P2R9 LinkDB All DBs Position 19:complement(780425..782999) Genome browser AA seq 210 aa AA seqDB search MPPYTIVYFPSRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGD LTLYQSNAILRHLGRSLGLYGKNQKEAAQVDMVNDGVEDLRCKYVTLIYTNYENGKNDYV KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDSFPLLSAY VARLSARPKIKAFLSSPEHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccatacaccattgtctacttcccaagtcgagggcggtgtgaggccatgcgcatg ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatacctggatg caaggcttgctcaagcccacttgtctgtatgggcagcttcccaagtttgaggatggagac ctcaccctttaccaatctaatgccatcttgagacaccttggccgctctttggggctttat gggaagaaccagaaggaggccgcccaggtggatatggtgaatgatggggtggaggacctt cgctgcaaatatgtcaccctcatctacaccaactatgaaaatggtaagaatgactatgtg aaggccctgcctgggcatctgaagccttttgagaccctgctgtcccagaaccagggaggc aaagctttcatcgtgggtgaccagatctcctttgccgattacaacttgctggacctgctg ctgatccaccaagtcctggcccctggctgcctggacagcttccccctgctctctgcctat gtggctcgcctcagtgccaggcccaagatcaaggcctttctgtcctccccggaacatgtg aaccgccccatcaatggcaatggcaaacagtag

DBGET integrated database retrieval system