Macaca mulatta (rhesus monkey): 107000212 Help Entry 107000212         CDS       T01028                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04360   Axon guidance mcc04666   Fc gamma R-mediated phagocytosis mcc04810   Regulation of actin cytoskeleton mcc05133   Pertussis mcc05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:mcc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     107000212  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     107000212   09158 Development and regeneration    04360 Axon guidance     107000212  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107000212   09171 Infectious disease: bacterial    05133 Pertussis     107000212  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcc04131]     107000212   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mcc04812]     107000212    04147 Exosome [BR:mcc04147]     107000212 Membrane trafficking [BR:mcc04131]  Others   Actin-binding proteins    Others     107000212 Cytoskeleton proteins [BR:mcc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      107000212 Exosome [BR:mcc04147]  Exosomal proteins   Proteins found in most exosomes    107000212 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF4899 Motif Other DBs NCBI-GeneID:  107000212 NCBI-ProteinID:  XP_028682462 LinkDB All DBs Position 9:88077704..88109814 Genome browser AA seq 122 aa AA seqDB search MGCHVAVFDDVIQLFSDMKVCKSSTLEKAKKRKKLLPFCLSEYKKNIILAEANKILVINV DQTIDDPYTTFVKMLTGDIGKEWSQEWEQPVAGGCTLGASQDKDTMSRKEISEMTYGSEP CM NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgggctgccatgtggctgtctttgatgatgtcatccagttgttcagtgacatgaaagtg tgcaagtcttcaacactagaaaaggcgaagaagcgcaagaagttgctgcccttctgcctg agtgagtacaagaagaacatcattctcgcagaggccaacaagatcctggtaattaatgtg gaccaaaccattgatgatccctataccacctttgtcaagatgctgacaggtgatatagga aaagagtggtcccaagagtgggagcagccggtggccgggggctgcaccctgggagctagc caagacaaagataccatgtccagaaaagaaatttcagaaatgacttatggctcagagcca tgtatgtaa

DBGET integrated database retrieval system