Methylobacterium currus: DA075_13705 Help Entry DA075_13705       CDS       T05184                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mee  Methylobacterium currus Pathway mee00190   Oxidative phosphorylation mee01100   Metabolic pathways Module mee_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mee00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DA075_13705  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mee00194]     DA075_13705 Photosynthesis proteins [BR:mee00194]  Photosystem and electron transport system   F-type ATPase [OT]    DA075_13705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AWB21845 UniProt:  A0A2R4WK14 LinkDB All DBs Position 1:complement(2932117..2932344) Genome browser AA seq 75 aa AA seqDB search MDPVAAKYIGAGLACLGMAGAAVGLGNLFGQFFAGALRNPSAADSQRPNLLLGFALTEAL GIFSLLVALLLLFAV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatcccgttgctgcgaagtacatcggcgccggcctcgcctgcctcggcatggcgggc gccgccgtgggcctcggcaacctgttcggccagttcttcgccggcgccctgcgcaacccc tccgcggccgacagccagcgccccaacctgctcctcggcttcgcgctgaccgaggcgctg ggcatcttctcgctgctcgtcgcgctgctgctgctgttcgccgtctga

DBGET integrated database retrieval system