Microtus fortis (reed vole): 126495784 Help Entry 126495784         CDS       T08493                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism mfot  Microtus fortis (reed vole) Pathway mfot04060   Cytokine-cytokine receptor interaction mfot04061   Viral protein interaction with cytokine and cytokine receptor mfot04062   Chemokine signaling pathway mfot04064   NF-kappa B signaling pathway mfot04620   Toll-like receptor signaling pathway mfot04623   Cytosolic DNA-sensing pathway mfot05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:mfot00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     126495784   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     126495784    04061 Viral protein interaction with cytokine and cytokine receptor     126495784  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     126495784    04623 Cytosolic DNA-sensing pathway     126495784    04062 Chemokine signaling pathway     126495784  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     126495784  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mfot04052]     126495784 Cytokines and neuropeptides [BR:mfot04052]  Cytokines   Chemokines    126495784 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  126495784 NCBI-ProteinID:  XP_049989340 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MKLCAYTLSLLLFAAAFCTPALSAPMGSDPPTSCCFSYTSSKLPRKFVIDYYETSSLCSK PAVVFLTRKGKQVCADPSLPWVNEYVNDLEMN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcgcatataccctctctctcctcctgtttgcagctgccttctgcactcca gcgctctcagcaccaatgggctctgaccctcccacttcctgctgcttttcttacacctct tcgaagctccctcgcaaatttgtgatagactactatgagaccagcagcctctgctccaaa ccagctgtggtattcctgaccagaaaaggcaaacaagtctgtgctgaccccagcctgccc tgggtcaatgagtacgtgaatgacttggagatgaactga

DBGET integrated database retrieval system