Microtus fortis (reed vole): 126498868 Help Entry 126498868         CDS       T08493                                  Name (RefSeq) cofilin-1   KO K05765   cofilin Organism mfot  Microtus fortis (reed vole) Pathway mfot04360   Axon guidance mfot04666   Fc gamma R-mediated phagocytosis mfot04810   Regulation of actin cytoskeleton mfot05133   Pertussis mfot05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:mfot00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     126498868  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     126498868   09158 Development and regeneration    04360 Axon guidance     126498868  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     126498868   09171 Infectious disease: bacterial    05133 Pertussis     126498868  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mfot04131]     126498868   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mfot04812]     126498868    04147 Exosome [BR:mfot04147]     126498868 Membrane trafficking [BR:mfot04131]  Others   Actin-binding proteins    Others     126498868 Cytoskeleton proteins [BR:mfot04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      126498868 Exosome [BR:mfot04147]  Exosomal proteins   Proteins found in most exosomes    126498868 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  126498868 NCBI-ProteinID:  XP_049993772 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggtgtcatcaaggtgttcaatgacatgaaggtg cgcaagtcttcgacgccagaagaagtgaagaaacgtaagaaggcggtgctcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagattctggtaggagatgtg gggcagactgtggacgatccctacaccacctttgtcaagatgctgccagacaaggactgc cgctatgctctctatgatgccacctatgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggcccctgagagtgcaccccttaagagcaaaatgatctacgccagttcc aaggatgccatcaagaagaaactgacaggaatcaagcatgaattacaagcaaactgctac gaggaggtgaaggaccgctgcaccctggcagagaaactaggtggcagtgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system