Manis javanica (Malayan pangolin): 108393034 Help Entry 108393034         CDS       T06054                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01523   Antifolate resistance mjv04010   MAPK signaling pathway mjv04060   Cytokine-cytokine receptor interaction mjv04064   NF-kappa B signaling pathway mjv04217   Necroptosis mjv04380   Osteoclast differentiation mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04623   Cytosolic DNA-sensing pathway mjv04625   C-type lectin receptor signaling pathway mjv04640   Hematopoietic cell lineage mjv04657   IL-17 signaling pathway mjv04659   Th17 cell differentiation mjv04668   TNF signaling pathway mjv04750   Inflammatory mediator regulation of TRP channels mjv04932   Non-alcoholic fatty liver disease mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04936   Alcoholic liver disease mjv04940   Type I diabetes mellitus mjv05010   Alzheimer disease mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05132   Salmonella infection mjv05133   Pertussis mjv05134   Legionellosis mjv05135   Yersinia infection mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05143   African trypanosomiasis mjv05144   Malaria mjv05146   Amoebiasis mjv05152   Tuberculosis mjv05162   Measles mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05168   Herpes simplex virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05321   Inflammatory bowel disease mjv05323   Rheumatoid arthritis mjv05332   Graft-versus-host disease mjv05417   Lipid and atherosclerosis mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108393034 (IL1B)    04064 NF-kappa B signaling pathway     108393034 (IL1B)    04668 TNF signaling pathway     108393034 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108393034 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108393034 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     108393034 (IL1B)    04620 Toll-like receptor signaling pathway     108393034 (IL1B)    04621 NOD-like receptor signaling pathway     108393034 (IL1B)    04623 Cytosolic DNA-sensing pathway     108393034 (IL1B)    04625 C-type lectin receptor signaling pathway     108393034 (IL1B)    04659 Th17 cell differentiation     108393034 (IL1B)    04657 IL-17 signaling pathway     108393034 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     108393034 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     108393034 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     108393034 (IL1B)    05164 Influenza A     108393034 (IL1B)    05162 Measles     108393034 (IL1B)    05168 Herpes simplex virus 1 infection     108393034 (IL1B)    05163 Human cytomegalovirus infection     108393034 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     108393034 (IL1B)    05135 Yersinia infection     108393034 (IL1B)    05133 Pertussis     108393034 (IL1B)    05134 Legionellosis     108393034 (IL1B)    05152 Tuberculosis     108393034 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     108393034 (IL1B)    05144 Malaria     108393034 (IL1B)    05140 Leishmaniasis     108393034 (IL1B)    05142 Chagas disease     108393034 (IL1B)    05143 African trypanosomiasis     108393034 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     108393034 (IL1B)    05321 Inflammatory bowel disease     108393034 (IL1B)    05332 Graft-versus-host disease     108393034 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     108393034 (IL1B)    05020 Prion disease     108393034 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     108393034 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108393034 (IL1B)    05418 Fluid shear stress and atherosclerosis     108393034 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     108393034 (IL1B)    04936 Alcoholic liver disease     108393034 (IL1B)    04932 Non-alcoholic fatty liver disease     108393034 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     108393034 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     108393034 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108393034 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108393034 (IL1B) Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Interleukins    108393034 (IL1B) Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Cytokines    108393034 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep PACT_coil_coil Motif Other DBs NCBI-GeneID:  108393034 NCBI-ProteinID:  XP_017509101 LinkDB All DBs Position Unknown AA seq 266 aa AA seqDB search MAAVPELASEQMEYYSDENDLLFEVDGPRQMKCCFQDVDLACLGDEGIQLQISHQLYNKS FRQVVSVIVAVEKMRKMPIPCSQVFQDDDLRSLFSFIFQEEPVFCTWDDDYVCDAPPQFL NCRLRDIDQKCLVLSGSYELQALHLNGQDVNRQVVFCMSFVQADENNDKIPVALGLKEKN LYLSCVMKDSKPTLQLEMVDPKKYPKRKMEKRFVFHKTEIKDKVEFESAQYPHWYISTSQ AEEMPVFLGSTRGGQDITDFTMEISP NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtacctgaactggccagtgaacagatggagtactacagtgatgagaatgac ctgctctttgaggtcgatggccccagacagatgaagtgctgcttccaagacgtggacctt gcctgtctgggcgacgagggaatccagctgcaaatctcccaccagctctacaacaagagt ttccggcaggtggtgtccgtcatcgtggctgtggagaagatgcggaagatgccaattccc tgctcacaggtcttccaggatgatgacctgaggagcctcttttccttcatctttcaagaa gagcctgtcttctgtacatgggatgatgattatgtgtgtgatgcgcccccgcaattcctg aactgcagactccgggatatagaccaaaagtgcctagtgctgtctggctcgtatgagctg caggcgctccacctcaatggacaggatgtgaaccgacaagtggtgttctgcatgagtttt gtgcaagcagacgaaaataacgacaagatacctgtggccttaggtctcaaggagaagaat ctgtacctctcctgtgtgatgaaagacagcaagcctaccctgcagctggagatggtggac cccaagaagtacccaaagaggaagatggaaaagcgctttgtcttccacaagactgaaatc aaagacaaggtggaatttgagtcagcccagtacccccactggtatatcagcacctcccaa gcagaagaaatgcctgtcttcctaggaagcaccagaggcggccaggatataactgacttc accatggaaatctctccctaa

DBGET integrated database retrieval system