Manis javanica (Malayan pangolin): 108396077 Help Entry 108396077         CDS       T06054                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv00190   Oxidative phosphorylation mjv01100   Metabolic pathways mjv01524   Platinum drug resistance mjv04115   p53 signaling pathway mjv04210   Apoptosis mjv04215   Apoptosis - multiple species mjv04932   Non-alcoholic fatty liver disease mjv05010   Alzheimer disease mjv05012   Parkinson disease mjv05014   Amyotrophic lateral sclerosis mjv05016   Huntington disease mjv05017   Spinocerebellar ataxia mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05132   Salmonella infection mjv05134   Legionellosis mjv05145   Toxoplasmosis mjv05152   Tuberculosis mjv05160   Hepatitis C mjv05161   Hepatitis B mjv05162   Measles mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05168   Herpes simplex virus 1 infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05200   Pathways in cancer mjv05210   Colorectal cancer mjv05222   Small cell lung cancer mjv05416   Viral myocarditis mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     108396077  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     108396077    04215 Apoptosis - multiple species     108396077    04115 p53 signaling pathway     108396077  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108396077   09162 Cancer: specific types    05210 Colorectal cancer     108396077    05222 Small cell lung cancer     108396077   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108396077    05161 Hepatitis B     108396077    05160 Hepatitis C     108396077    05164 Influenza A     108396077    05162 Measles     108396077    05168 Herpes simplex virus 1 infection     108396077    05163 Human cytomegalovirus infection     108396077    05167 Kaposi sarcoma-associated herpesvirus infection     108396077    05169 Epstein-Barr virus infection     108396077   09171 Infectious disease: bacterial    05132 Salmonella infection     108396077    05134 Legionellosis     108396077    05152 Tuberculosis     108396077   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108396077   09164 Neurodegenerative disease    05010 Alzheimer disease     108396077    05012 Parkinson disease     108396077    05014 Amyotrophic lateral sclerosis     108396077    05016 Huntington disease     108396077    05017 Spinocerebellar ataxia     108396077    05020 Prion disease     108396077    05022 Pathways of neurodegeneration - multiple diseases     108396077   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108396077    05416 Viral myocarditis     108396077   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     108396077   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     108396077 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  108396077 NCBI-ProteinID:  XP_036846433 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW GDETLMEYLENPKKYIPGTKMIFAGIKKSSERADLIAYLKTATKE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgacgttgagaagggcaagaagatttttgttcagaaatgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttgggcgaaag acaggtcaggcccctggattttcttacacagatgccaacaagaacaaaggcatcacctgg ggagatgagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagtcatcagaaagggccgacttgatagcttatctcaaa acagctactaaggagtaa

DBGET integrated database retrieval system