Mandrillus leucophaeus (drill): 105539032 Help Entry 105539032         CDS       T08763                                  Name (RefSeq) C-C motif chemokine 4-like   KO K12964   C-C motif chemokine 4 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04061   Viral protein interaction with cytokine and cytokine receptor mleu04062   Chemokine signaling pathway mleu04064   NF-kappa B signaling pathway mleu04620   Toll-like receptor signaling pathway mleu04623   Cytosolic DNA-sensing pathway mleu05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105539032   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105539032    04061 Viral protein interaction with cytokine and cytokine receptor     105539032  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105539032    04623 Cytosolic DNA-sensing pathway     105539032    04062 Chemokine signaling pathway     105539032  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     105539032  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105539032 Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Chemokines    105539032 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105539032 NCBI-ProteinID:  XP_011834530 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MKLCVTVLSLLVLAAAFCSPALSAPMGSDPPTACCFSYTVRKLPRNFVVDYYETSSLCSQ PAVV NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaagctgtgcgtgactgtcctgtctctcctcgtgctagcagctgccttctgctctcca gcactctcagcaccaatgggctcagaccctcccaccgcctgctgcttttcttacaccgtg aggaagcttcctcgcaactttgtggtagattactacgagaccagcagcctctgctcccag ccagctgtggtgtga

DBGET integrated database retrieval system