Mandrillus leucophaeus (drill): 105545988 Help Entry 105545988         CDS       T08763                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04146   Peroxisome mleu04213   Longevity regulating pathway - multiple species mleu05012   Parkinson disease mleu05014   Amyotrophic lateral sclerosis mleu05016   Huntington disease mleu05020   Prion disease mleu05022   Pathways of neurodegeneration - multiple diseases mleu05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:mleu00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     105545988 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     105545988 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     105545988 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     105545988 (SOD1)    05014 Amyotrophic lateral sclerosis     105545988 (SOD1)    05016 Huntington disease     105545988 (SOD1)    05020 Prion disease     105545988 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     105545988 (SOD1) Enzymes [BR:mleu01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      105545988 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  105545988 NCBI-ProteinID:  XP_011844452 Ensembl:  ENSMLEG00000034867 LinkDB All DBs Position Unknown AA seq 141 aa AA seqDB search MVRDKLLNDSCKINGPVKVWGSITGLTEGLHGFHVHQFGDNTQGCTSAGPHFNPLSRQHG GPKDEERHVGDLGNVTAGKDGVANVSFEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNE ESKKTGKAGGRLACGVIGIAQ NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggtcagagacaaacttctgaacgactcttgtaaaattaatggaccagtgaaggtgtgg ggaagcattacaggattgactgaaggcctgcatggattccatgttcatcagtttggagat aatacacaaggctgtaccagtgcaggtcctcactttaatcctctatccagacaacatggt gggccaaaggatgaagagaggcatgttggagacctgggcaatgtgaccgctggcaaagat ggtgtggccaatgtgtctttcgaagattctgtgatctcactctcaggagaccattccatc attggccgcacattggtggtccatgaaaaagcagatgacttgggcaaaggtggaaatgaa gaaagtaaaaagacaggaaaggctggaggtcgtctggcttgtggtgtaattgggatcgcc caataa

DBGET integrated database retrieval system