Mustela lutreola (European mink): 131825303 Help Entry 131825303         CDS       T09578                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism mlk  Mustela lutreola (European mink) Pathway mlk04146   Peroxisome mlk04213   Longevity regulating pathway - multiple species mlk05012   Parkinson disease mlk05014   Amyotrophic lateral sclerosis mlk05016   Huntington disease mlk05020   Prion disease mlk05022   Pathways of neurodegeneration - multiple diseases mlk05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:mlk00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     131825303 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     131825303 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     131825303 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     131825303 (SOD1)    05014 Amyotrophic lateral sclerosis     131825303 (SOD1)    05016 Huntington disease     131825303 (SOD1)    05020 Prion disease     131825303 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     131825303 (SOD1) Enzymes [BR:mlk01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      131825303 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  131825303 NCBI-ProteinID:  XP_059020565 LinkDB All DBs Position 2:212435271..212444105 Genome browser AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGKGPVEVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKNHGGPKDQERHVGDLGNVTAGKDGVAIVSMEDSLISLSGDYSIIGRTMVVH EKQDDLGRGGNEESTKTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgttgaagggccagggcccggtggagggcaccatccac ttcgtgcagaagggaaaggggcccgttgaggtgtcaggaaccattacaggattgactgaa ggcgagcatggattccacgtccatcagtttggagataatacacaaggctgtaccagtgca ggtcctcactttaatcctctatccaaaaatcacggtgggccgaaagaccaagagaggcat gttggagacctgggcaatgtgactgctggcaaggatggcgtggccattgtgtctatggaa gattctctgatctcactctcaggagactattccatcattggccgcacaatggtggtccat gagaaacaagatgacttgggcagaggtggcaatgaagagagtacaaagacgggaaacgcc gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system