Marmota marmota marmota (Alpine marmot): 107157771 Help Entry 107157771         CDS       T09644                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04613   Neutrophil extracellular trap formation mmma05034   Alcoholism mmma05202   Transcriptional misregulation in cancer mmma05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmma00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107157771  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     107157771   09163 Immune disease    05322 Systemic lupus erythematosus     107157771   09165 Substance dependence    05034 Alcoholism     107157771  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmma03036]     107157771   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107157771 Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107157771 Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107157771 BRITE hierarchy Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  107157771 NCBI-ProteinID:  XP_015359661 Ensembl:  ENSMMMG00000010351 UniProt:  A0A8C5ZAU0 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagaccgcgcgtaagtccactggtgggaaagccccccgcaaacag ctggccaccaaggctgccaggaaaagcgccccctctaccggcggggtgaagaaacctcat cgctacaggcccgggactgtggctcttcgagagattcgtcgttaccagaagtcgaccgag cttctcatccggaagttgcctttccagagattggtgagagagatcgcccaggatttcaaa accgacttgaggtttcagagtgcagccattggcgcccttcaggaggctagtgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system