Mus musculus (house mouse): 319177 Help Entry 319177            CDS       T01002                                  Symbol H2bc1, Hist1h2ba, Th2b Name (RefSeq) H2B clustered histone 1   KO K11252   histone H2B Organism mmu  Mus musculus (house mouse) Pathway mmu04613   Neutrophil extracellular trap formation mmu05034   Alcoholism mmu05203   Viral carcinogenesis mmu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     319177 (H2bc1)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     319177 (H2bc1)   09163 Immune disease    05322 Systemic lupus erythematosus     319177 (H2bc1)   09165 Substance dependence    05034 Alcoholism     319177 (H2bc1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     319177 (H2bc1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     319177 (H2bc1) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     319177 (H2bc1) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    319177 (H2bc1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa FMN_bind Motif Other DBs NCBI-GeneID:  319177 NCBI-ProteinID:  NP_783594 MGI:  2448375 Ensembl:  ENSMUSG00000050799 UniProt:  P70696 Structure PDB LinkDB All DBs Position 13:complement(24117708..24118139) Genome browser AA seq 127 aa AA seqDB search MPEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKA MSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccggaggtggcggtaaagggtgctactatttccaagaaaggcttcaagaaagcggtc accaagacccagaaaaaggagggccggaaacgtaagagatgccgcaaggagagctactcc atttacatctataaggtgctgaaacaagtgcaccccgacaccggcatctcctccaaggcc atgagcatcatgaactcctttgtgacagacatcttcgagcgcatcgcgagcgaggcgtcc cgcctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtg cgcctgctgctgcccggggagctggccaagcacgcggtgtcggagggcaccaaggccgtc accaagtacaccagctccaagtga

DBGET integrated database retrieval system