Mus musculus (house mouse): 494124 Help Entry 494124            CDS       T01002                                  Symbol Calm5, Scarf2 Name (RefSeq) calmodulin 5   KO K02183   calmodulin Organism mmu  Mus musculus (house mouse) Pathway mmu04014   Ras signaling pathway mmu04015   Rap1 signaling pathway mmu04020   Calcium signaling pathway mmu04022   cGMP-PKG signaling pathway mmu04024   cAMP signaling pathway mmu04070   Phosphatidylinositol signaling system mmu04114   Oocyte meiosis mmu04218   Cellular senescence mmu04261   Adrenergic signaling in cardiomyocytes mmu04270   Vascular smooth muscle contraction mmu04371   Apelin signaling pathway mmu04625   C-type lectin receptor signaling pathway mmu04713   Circadian entrainment mmu04720   Long-term potentiation mmu04722   Neurotrophin signaling pathway mmu04728   Dopaminergic synapse mmu04740   Olfactory transduction mmu04744   Phototransduction mmu04750   Inflammatory mediator regulation of TRP channels mmu04910   Insulin signaling pathway mmu04912   GnRH signaling pathway mmu04915   Estrogen signaling pathway mmu04916   Melanogenesis mmu04921   Oxytocin signaling pathway mmu04922   Glucagon signaling pathway mmu04924   Renin secretion mmu04925   Aldosterone synthesis and secretion mmu04970   Salivary secretion mmu04971   Gastric acid secretion mmu05010   Alzheimer disease mmu05012   Parkinson disease mmu05022   Pathways of neurodegeneration - multiple diseases mmu05031   Amphetamine addiction mmu05034   Alcoholism mmu05133   Pertussis mmu05152   Tuberculosis mmu05163   Human cytomegalovirus infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05170   Human immunodeficiency virus 1 infection mmu05200   Pathways in cancer mmu05214   Glioma mmu05417   Lipid and atherosclerosis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     494124 (Calm5)    04015 Rap1 signaling pathway     494124 (Calm5)    04371 Apelin signaling pathway     494124 (Calm5)    04020 Calcium signaling pathway     494124 (Calm5)    04070 Phosphatidylinositol signaling system     494124 (Calm5)    04024 cAMP signaling pathway     494124 (Calm5)    04022 cGMP-PKG signaling pathway     494124 (Calm5)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     494124 (Calm5)    04218 Cellular senescence     494124 (Calm5)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     494124 (Calm5)   09152 Endocrine system    04910 Insulin signaling pathway     494124 (Calm5)    04922 Glucagon signaling pathway     494124 (Calm5)    04912 GnRH signaling pathway     494124 (Calm5)    04915 Estrogen signaling pathway     494124 (Calm5)    04921 Oxytocin signaling pathway     494124 (Calm5)    04916 Melanogenesis     494124 (Calm5)    04924 Renin secretion     494124 (Calm5)    04925 Aldosterone synthesis and secretion     494124 (Calm5)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     494124 (Calm5)    04270 Vascular smooth muscle contraction     494124 (Calm5)   09154 Digestive system    04970 Salivary secretion     494124 (Calm5)    04971 Gastric acid secretion     494124 (Calm5)   09156 Nervous system    04728 Dopaminergic synapse     494124 (Calm5)    04720 Long-term potentiation     494124 (Calm5)    04722 Neurotrophin signaling pathway     494124 (Calm5)   09157 Sensory system    04744 Phototransduction     494124 (Calm5)    04740 Olfactory transduction     494124 (Calm5)    04750 Inflammatory mediator regulation of TRP channels     494124 (Calm5)   09159 Environmental adaptation    04713 Circadian entrainment     494124 (Calm5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     494124 (Calm5)   09162 Cancer: specific types    05214 Glioma     494124 (Calm5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     494124 (Calm5)    05163 Human cytomegalovirus infection     494124 (Calm5)    05167 Kaposi sarcoma-associated herpesvirus infection     494124 (Calm5)   09171 Infectious disease: bacterial    05133 Pertussis     494124 (Calm5)    05152 Tuberculosis     494124 (Calm5)   09164 Neurodegenerative disease    05010 Alzheimer disease     494124 (Calm5)    05012 Parkinson disease     494124 (Calm5)    05022 Pathways of neurodegeneration - multiple diseases     494124 (Calm5)   09165 Substance dependence    05031 Amphetamine addiction     494124 (Calm5)    05034 Alcoholism     494124 (Calm5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     494124 (Calm5)    05418 Fluid shear stress and atherosclerosis     494124 (Calm5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mmu01009]     494124 (Calm5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     494124 (Calm5)    03036 Chromosome and associated proteins [BR:mmu03036]     494124 (Calm5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     494124 (Calm5) Protein phosphatases and associated proteins [BR:mmu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      494124 (Calm5) Membrane trafficking [BR:mmu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     494124 (Calm5) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      494124 (Calm5) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    494124 (Calm5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 AIF-1 EF-hand_4 EF-hand_9 TerB WEF-hand Vps23_core RTX_C AAA_assoc_C DUF1722 TMP_3 Motif Other DBs NCBI-GeneID:  494124 NCBI-ProteinID:  NP_001008706 MGI:  3511177 Ensembl:  ENSMUSG00000099269 UniProt:  Q6W3E0 LinkDB All DBs Position 13:3904173..3904761 Genome browser AA seq 140 aa AA seqDB search MSHGFTKEENKDGHINVQELGDVMKQLGKNLSHEELKALISKLDTDGDGKISFEEFFKSI KKYTKEQELQAMFSVLDQNGDGYITVDELKEGLSKMGEPLSQEELEGMIHVFGADQDGKV NYEQFLSHYIETVYKVHISD NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgtctcacgggtttactaaggaggagaataaggatggccatatcaacgtccaggaactt ggagatgtaatgaagcagttgggcaagaacctctcacatgaggaactgaaggctctcatc tccaagttggacacagatggtgatggcaagatcagctttgaagaattctttaagtccatc aaaaagtacactaaagagcaggagctgcaggctatgttcagtgtccttgaccagaatggt gatgggtacatcactgtggatgagctcaaagaaggcttgtccaagatgggagagccgctt tcccaggaggagctggagggcatgatccatgtgtttggtgcagaccaagatgggaaggtg aactatgagcagtttttgagtcactacattgagactgtatacaaggtccacatatctgac tga

DBGET integrated database retrieval system