Mus musculus (house mouse): 75600 Help Entry 75600             CDS       T01002                                  Symbol Calml4, 2010002G05Rik Name (RefSeq) calmodulin-like 4   KO K02183   calmodulin Organism mmu  Mus musculus (house mouse) Pathway mmu04014   Ras signaling pathway mmu04015   Rap1 signaling pathway mmu04020   Calcium signaling pathway mmu04022   cGMP-PKG signaling pathway mmu04024   cAMP signaling pathway mmu04070   Phosphatidylinositol signaling system mmu04114   Oocyte meiosis mmu04218   Cellular senescence mmu04261   Adrenergic signaling in cardiomyocytes mmu04270   Vascular smooth muscle contraction mmu04371   Apelin signaling pathway mmu04625   C-type lectin receptor signaling pathway mmu04713   Circadian entrainment mmu04720   Long-term potentiation mmu04722   Neurotrophin signaling pathway mmu04728   Dopaminergic synapse mmu04740   Olfactory transduction mmu04744   Phototransduction mmu04750   Inflammatory mediator regulation of TRP channels mmu04910   Insulin signaling pathway mmu04912   GnRH signaling pathway mmu04915   Estrogen signaling pathway mmu04916   Melanogenesis mmu04921   Oxytocin signaling pathway mmu04922   Glucagon signaling pathway mmu04924   Renin secretion mmu04925   Aldosterone synthesis and secretion mmu04970   Salivary secretion mmu04971   Gastric acid secretion mmu05010   Alzheimer disease mmu05012   Parkinson disease mmu05022   Pathways of neurodegeneration - multiple diseases mmu05031   Amphetamine addiction mmu05034   Alcoholism mmu05133   Pertussis mmu05152   Tuberculosis mmu05163   Human cytomegalovirus infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05170   Human immunodeficiency virus 1 infection mmu05200   Pathways in cancer mmu05214   Glioma mmu05417   Lipid and atherosclerosis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     75600 (Calml4)    04015 Rap1 signaling pathway     75600 (Calml4)    04371 Apelin signaling pathway     75600 (Calml4)    04020 Calcium signaling pathway     75600 (Calml4)    04070 Phosphatidylinositol signaling system     75600 (Calml4)    04024 cAMP signaling pathway     75600 (Calml4)    04022 cGMP-PKG signaling pathway     75600 (Calml4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     75600 (Calml4)    04218 Cellular senescence     75600 (Calml4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     75600 (Calml4)   09152 Endocrine system    04910 Insulin signaling pathway     75600 (Calml4)    04922 Glucagon signaling pathway     75600 (Calml4)    04912 GnRH signaling pathway     75600 (Calml4)    04915 Estrogen signaling pathway     75600 (Calml4)    04921 Oxytocin signaling pathway     75600 (Calml4)    04916 Melanogenesis     75600 (Calml4)    04924 Renin secretion     75600 (Calml4)    04925 Aldosterone synthesis and secretion     75600 (Calml4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     75600 (Calml4)    04270 Vascular smooth muscle contraction     75600 (Calml4)   09154 Digestive system    04970 Salivary secretion     75600 (Calml4)    04971 Gastric acid secretion     75600 (Calml4)   09156 Nervous system    04728 Dopaminergic synapse     75600 (Calml4)    04720 Long-term potentiation     75600 (Calml4)    04722 Neurotrophin signaling pathway     75600 (Calml4)   09157 Sensory system    04744 Phototransduction     75600 (Calml4)    04740 Olfactory transduction     75600 (Calml4)    04750 Inflammatory mediator regulation of TRP channels     75600 (Calml4)   09159 Environmental adaptation    04713 Circadian entrainment     75600 (Calml4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     75600 (Calml4)   09162 Cancer: specific types    05214 Glioma     75600 (Calml4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     75600 (Calml4)    05163 Human cytomegalovirus infection     75600 (Calml4)    05167 Kaposi sarcoma-associated herpesvirus infection     75600 (Calml4)   09171 Infectious disease: bacterial    05133 Pertussis     75600 (Calml4)    05152 Tuberculosis     75600 (Calml4)   09164 Neurodegenerative disease    05010 Alzheimer disease     75600 (Calml4)    05012 Parkinson disease     75600 (Calml4)    05022 Pathways of neurodegeneration - multiple diseases     75600 (Calml4)   09165 Substance dependence    05031 Amphetamine addiction     75600 (Calml4)    05034 Alcoholism     75600 (Calml4)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     75600 (Calml4)    05418 Fluid shear stress and atherosclerosis     75600 (Calml4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mmu01009]     75600 (Calml4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     75600 (Calml4)    03036 Chromosome and associated proteins [BR:mmu03036]     75600 (Calml4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     75600 (Calml4) Protein phosphatases and associated proteins [BR:mmu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      75600 (Calml4) Membrane trafficking [BR:mmu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     75600 (Calml4) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      75600 (Calml4) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    75600 (Calml4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_9 EF-hand_6 EF-hand_1 EF-hand_8 AIF-1 EF-hand_4 EF-hand_11 FlgD Motif Other DBs NCBI-GeneID:  75600 NCBI-ProteinID:  NP_612177 MGI:  1922850 Ensembl:  ENSMUSG00000032246 UniProt:  Q91WQ9 LinkDB All DBs Position 9:62765068..62783203 Genome browser AA seq 153 aa AA seqDB search MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDK NGELDFSTFLTIMHMQIKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMKLGEKLTHK EVDDLFKEAGIEPNGQVKYDTFIQRITIPVRDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaagttcctttcccaggaccaaattaatgagtacaaggagtgcttctccctgtac gacaagcagcagagagggaagatcaaggccacagatcttctggtgtccatgaggtgccta ggggccagccccacgcctggggaagtgcagcggcacctgcagactcatgggatagacaag aacggagagctggacttctccaccttcctgaccatcatgcatatgcaaatcaagcaagag gacccaaagaaagaaatccttctggccatgctgatggcagacaaggagaagaaaggttac atcatggcgtctgagctgcggtcgaaactcatgaaactgggagagaagctcactcacaag gaagtggatgatcttttcaaggaagcaggcattgaaccaaacggccaagtgaaatatgac acgtttatccagaggatcaccattcctgtgcgagactactaa

DBGET integrated database retrieval system