Myotis myotis (greater mouse-eared bat): 118654109 Help Entry 118654109         CDS       T07220                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04613   Neutrophil extracellular trap formation mmyo05034   Alcoholism mmyo05202   Transcriptional misregulation in cancer mmyo05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmyo00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118654109  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     118654109   09163 Immune disease    05322 Systemic lupus erythematosus     118654109   09165 Substance dependence    05034 Alcoholism     118654109  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmyo03036]     118654109   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmyo04147]     118654109 Chromosome and associated proteins [BR:mmyo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118654109 Exosome [BR:mmyo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118654109 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-S CENP-T_C CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  118654109 NCBI-ProteinID:  XP_036161230 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGSVKKPHRYRPGTVALREIRRYQKFTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAFMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLASRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgaaccaagcagacggcgcgcaagtcgacgggcgggaaggcgccccgcaagcag ctggccaccaaggccgcccgcaagagcgcgccggccacgggcagcgtgaagaagccgcac cgctaccggcccggcaccgtggccctgcgcgagatccgccgctaccagaagttcacggag ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccttcatggcgctgcaggaggcgtgcgaggcctac ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctcgcgagccgcatccgcggcgagagggcgtaa

DBGET integrated database retrieval system