Myotis myotis (greater mouse-eared bat): 118674974 Help Entry 118674974         CDS       T07220                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo04146   Peroxisome mmyo04213   Longevity regulating pathway - multiple species mmyo05012   Parkinson disease mmyo05014   Amyotrophic lateral sclerosis mmyo05016   Huntington disease mmyo05020   Prion disease mmyo05022   Pathways of neurodegeneration - multiple diseases mmyo05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:mmyo00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     118674974 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     118674974 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     118674974 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     118674974 (SOD1)    05014 Amyotrophic lateral sclerosis     118674974 (SOD1)    05016 Huntington disease     118674974 (SOD1)    05020 Prion disease     118674974 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     118674974 (SOD1) Enzymes [BR:mmyo01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      118674974 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  118674974 NCBI-ProteinID:  XP_036202963 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MATKAVCVLRGDGPVHGTIHFELQGNGKVKVSGSIRELTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKTHGGPQDEERHVGDLGNVTAGPDGVANVLIEDSVIALSGDHSIIGRTLVVH EKRDDLGKGGNDESKKTGNAGSRLACGVIGITQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcgaccaaggccgtgtgcgtgctgaggggcgacggcccggtgcacggcaccatccac ttcgagctgcagggaaacgggaaggtcaaggtctcgggctccatcagagagctgacggag ggtgagcacggcttccatgtccaccagtttggagacaacacacaaggctgtaccagtgca ggccctcactttaaccctctgtccaagacccacggcgggccgcaggacgaagagaggcat gtcggggacctgggcaacgtgacggcaggcccggacggtgtggccaacgtgctcattgag gactctgtgattgcgctctcgggagaccattccatcattggccgcacactagtggtccat gagaagcgagatgacctgggcaaaggtgggaatgacgaaagcaagaagacgggcaacgcc gggagccgcctggcctgcggggtgatcggcatcacccagtga

DBGET integrated database retrieval system