Macaca nemestrina (pig-tailed macaque): 105469690 Help Entry 105469690         CDS       T08765                                  Symbol GSTP1 Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni00480   Glutathione metabolism mni00980   Metabolism of xenobiotics by cytochrome P450 mni00982   Drug metabolism - cytochrome P450 mni00983   Drug metabolism - other enzymes mni01100   Metabolic pathways mni01524   Platinum drug resistance mni05200   Pathways in cancer mni05204   Chemical carcinogenesis - DNA adducts mni05215   Prostate cancer mni05225   Hepatocellular carcinoma mni05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     105469690 (GSTP1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     105469690 (GSTP1)    00982 Drug metabolism - cytochrome P450     105469690 (GSTP1)    00983 Drug metabolism - other enzymes     105469690 (GSTP1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105469690 (GSTP1)    05204 Chemical carcinogenesis - DNA adducts     105469690 (GSTP1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     105469690 (GSTP1)    05215 Prostate cancer     105469690 (GSTP1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105469690 (GSTP1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105469690 (GSTP1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mni02000]     105469690 (GSTP1) Enzymes [BR:mni01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      105469690 (GSTP1) Transporters [BR:mni02000]  Other transporters   Pores ion channels [TC:1]    105469690 (GSTP1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 Motif Other DBs NCBI-GeneID:  105469690 NCBI-ProteinID:  XP_011719383 Ensembl:  ENSMNEG00000044300 UniProt:  A0A2K6E4Y3 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTMETWQEGSLKASCLYGQLPKFQDGD LTLYQSNTFLRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYLSLIYTNYEAGKDDYV KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY VARLSARPKLKAFLASPEHVNLPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccgtggtctacttcccagttcgaggccgctgcgccgccctgcgcatg ctgctggcagaccagggccagagctggaaggaggaggtggtgacaatggagacctggcaa gagggttctctcaaagcctcctgcctgtatgggcagctccccaagttccaggacggagac ctcaccctgtaccagtccaataccttcctgcgtcacctgggccgcactcttgggctctat gggaaggaccagcgggaggcagccctggtggacatggtgaatgacggcgtggaggacctc cgctgcaaatacctctccctcatctacaccaactacgaggcaggcaaggatgactatgtg aaggcactgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg ctgatccatgaggtcctggcccccggctgcctggatgcgttccccctgctctcggcatat gtggcgcgcctcagtgcccggcccaagctcaaggctttcctggcctcccctgagcatgtg aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system