Mustela nigripes (black-footed ferret): 132027152 Help Entry 132027152         CDS       T09425                                  Symbol MYL10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04510   Focal adhesion mnp04520   Adherens junction mnp04670   Leukocyte transendothelial migration mnp04810   Regulation of actin cytoskeleton mnp04814   Motor proteins mnp05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mnp00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     132027152 (MYL10)    04520 Adherens junction     132027152 (MYL10)   09142 Cell motility    04814 Motor proteins     132027152 (MYL10)    04810 Regulation of actin cytoskeleton     132027152 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     132027152 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132027152 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mnp04812]     132027152 (MYL10) Cytoskeleton proteins [BR:mnp04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      132027152 (MYL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 Motif Other DBs NCBI-GeneID:  132027152 NCBI-ProteinID:  XP_059271912 LinkDB All DBs Position 11:complement(7935070..7939482) Genome browser AA seq 147 aa AA seqDB search MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF TVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFIKADFIKEKLMTQADRFSEDEVKQMF AAFPPDACGNLDYQNLCYVITHGEEKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtttgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccagaac cgggatggcttcattgacaaggaggacctgagggacacctttgccgccttgggccgcatc aatgtgaagaatgaggagctggaagccatggtgaaggaggcgcctggacccatcaacttc accgtcttcctgaccatgtttggggagaagctgaagggtacggaccccgaggagaccatc ctccatgccttcaaggtgtttgacactgaagggaaaggtttcatcaaggctgatttcatc aaagagaagctcatgacccaggccgaccggttcagtgaggacgaggtcaagcagatgttt gcggctttcccgccagatgcgtgcggtaacctggattaccagaacctgtgttacgtcatc acgcatggagaggagaaggactag

DBGET integrated database retrieval system