Microtus oregoni (creeping vole): 121434736 Help Entry 121434736         CDS       T08307                                  Name (RefSeq) cytochrome c, somatic   KO K08738   cytochrome c Organism morg  Microtus oregoni (creeping vole) Pathway morg00190   Oxidative phosphorylation morg01100   Metabolic pathways morg01524   Platinum drug resistance morg04115   p53 signaling pathway morg04210   Apoptosis morg04215   Apoptosis - multiple species morg04932   Non-alcoholic fatty liver disease morg05010   Alzheimer disease morg05012   Parkinson disease morg05014   Amyotrophic lateral sclerosis morg05016   Huntington disease morg05017   Spinocerebellar ataxia morg05020   Prion disease morg05022   Pathways of neurodegeneration - multiple diseases morg05132   Salmonella infection morg05134   Legionellosis morg05145   Toxoplasmosis morg05152   Tuberculosis morg05160   Hepatitis C morg05161   Hepatitis B morg05162   Measles morg05163   Human cytomegalovirus infection morg05164   Influenza A morg05167   Kaposi sarcoma-associated herpesvirus infection morg05168   Herpes simplex virus 1 infection morg05169   Epstein-Barr virus infection morg05170   Human immunodeficiency virus 1 infection morg05200   Pathways in cancer morg05210   Colorectal cancer morg05222   Small cell lung cancer morg05416   Viral myocarditis morg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     121434736  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     121434736    04215 Apoptosis - multiple species     121434736    04115 p53 signaling pathway     121434736  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121434736   09162 Cancer: specific types    05210 Colorectal cancer     121434736    05222 Small cell lung cancer     121434736   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121434736    05161 Hepatitis B     121434736    05160 Hepatitis C     121434736    05164 Influenza A     121434736    05162 Measles     121434736    05168 Herpes simplex virus 1 infection     121434736    05163 Human cytomegalovirus infection     121434736    05167 Kaposi sarcoma-associated herpesvirus infection     121434736    05169 Epstein-Barr virus infection     121434736   09171 Infectious disease: bacterial    05132 Salmonella infection     121434736    05134 Legionellosis     121434736    05152 Tuberculosis     121434736   09174 Infectious disease: parasitic    05145 Toxoplasmosis     121434736   09164 Neurodegenerative disease    05010 Alzheimer disease     121434736    05012 Parkinson disease     121434736    05014 Amyotrophic lateral sclerosis     121434736    05016 Huntington disease     121434736    05017 Spinocerebellar ataxia     121434736    05020 Prion disease     121434736    05022 Pathways of neurodegeneration - multiple diseases     121434736   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121434736    05416 Viral myocarditis     121434736   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     121434736   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     121434736 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  121434736 NCBI-ProteinID:  XP_041489609 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATKE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgacgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccacact gtggaaaagggaggcaagcataagactggaccaaacctccacggtctgtttgggaggaag acaggtcaggcggctggattttcgtacacagatgccaacaagaacaaaggcatcacctgg ggagaggacaccctgatggagtatttggagaatcccaaaaagtacatccctggaacaaaa atgatcttcgctggaattaagaagaagggagagagggcggacctaatagcttatcttaaa aaggctactaaggagtaa

DBGET integrated database retrieval system