Mus pahari (shrew mouse): 110320129 Help Entry 110320129         CDS       T05929                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism mpah  Mus pahari (shrew mouse) Pathway mpah04613   Neutrophil extracellular trap formation mpah05034   Alcoholism mpah05203   Viral carcinogenesis mpah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110320129  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     110320129   09163 Immune disease    05322 Systemic lupus erythematosus     110320129   09165 Substance dependence    05034 Alcoholism     110320129  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpah03036]     110320129   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110320129 Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110320129 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110320129 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  110320129 NCBI-ProteinID:  XP_021051698 Ensembl:  MGP_PahariEiJ_G0026820 LinkDB All DBs Position 4:86467335..86470190 Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcgaagtccgctcctgctccaaagaagggctccaagaaagctgtcacg aaagtgcagaagaaagatggcaagaagcgcaagcgcagccgcaaggagagctattctgtc tacgtgtacaaggtgctgaagcaagtgcacccagacaccggcatctcatctaaggctatg ggaatcatgaattccttcgtgaatgacatcttcgagcgcatcgcaggagaggcttcccgt ctggcgcattacaacaagcgctcgaccatcacatcccgggagatccagacggccgtgcgt ctgctgctgcccggggagttggctaaacacgctgtgtcggagggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system