Mus pahari (shrew mouse): 110329810 Help Entry 110329810         CDS       T05929                                  Symbol Sod1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism mpah  Mus pahari (shrew mouse) Pathway mpah04146   Peroxisome mpah04213   Longevity regulating pathway - multiple species mpah05012   Parkinson disease mpah05014   Amyotrophic lateral sclerosis mpah05016   Huntington disease mpah05020   Prion disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:mpah00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     110329810 (Sod1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     110329810 (Sod1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     110329810 (Sod1)   09164 Neurodegenerative disease    05012 Parkinson disease     110329810 (Sod1)    05014 Amyotrophic lateral sclerosis     110329810 (Sod1)    05016 Huntington disease     110329810 (Sod1)    05020 Prion disease     110329810 (Sod1)    05022 Pathways of neurodegeneration - multiple diseases     110329810 (Sod1) Enzymes [BR:mpah01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      110329810 (Sod1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  110329810 NCBI-ProteinID:  XP_021065350 Ensembl:  MGP_PahariEiJ_G0016648 LinkDB All DBs Position 12:81304533..81310219 Genome browser AA seq 154 aa AA seqDB search MAMKAVCVLKGDGPVRGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTS AGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVV HEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggcgatgaaagccgtgtgcgtgctgaaaggcgacggtccggtgcgggggaccatccac ttcgagcagaaggcaagtggtgaaccagttgtgttgtcaggacaaattacaggattaact gaaggccagcatgggttccacgtccatcagtatggggataatacacaaggctgtaccagt gcaggacctcattttaaccctcactctaagaaacatggcggcccagcggatgaagagagg catgttggagacctgggcaatgtgactgctggaaaggacggtgtggccaatgtgtccatt gaagatcgtgtgatctcactctcaggagagcattccatcattggccgtacaatggtggtc cacgagaaacaagatgacttgggcaaaggtggaaatgaagaaagtacgaagactggaaat gctgggagccgcttggcctgtggtgtgattgggattgcccaataa

DBGET integrated database retrieval system