Mustela putorius furo (domestic ferret): 101670031 Help Entry 101670031         CDS       T07239                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04146   Peroxisome mpuf04213   Longevity regulating pathway - multiple species mpuf05012   Parkinson disease mpuf05014   Amyotrophic lateral sclerosis mpuf05016   Huntington disease mpuf05020   Prion disease mpuf05022   Pathways of neurodegeneration - multiple diseases mpuf05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:mpuf00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     101670031 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     101670031 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     101670031 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     101670031 (SOD1)    05014 Amyotrophic lateral sclerosis     101670031 (SOD1)    05016 Huntington disease     101670031 (SOD1)    05020 Prion disease     101670031 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     101670031 (SOD1) Enzymes [BR:mpuf01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      101670031 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  101670031 NCBI-ProteinID:  XP_012914294 Ensembl:  ENSMPUG00000001069 UniProt:  M3XPR0 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGKGPVEVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKNHGGPKDQERHVGDLGNVTAGKDGVAIVSMEDSLISLSGDYSIIGRTMVVH EKQDDLGRGGNEESTKTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgttgaagggccagggcccggtggagggcaccatccac ttcgtgcagaagggaaaggggcccgttgaggtgtcaggaaccattacaggattgactgaa ggcgagcatggattccacgtccatcagtttggagataatacacaaggctgtaccagcgca ggtcctcactttaatcctctatccaaaaatcacggtgggccgaaagaccaagagaggcat gttggagacctgggcaatgtgactgctggcaaggatggcgtggccattgtgtccatggaa gattctctgatctcactctcaggagactattccatcattggccgcacaatggtggtccat gagaaacaagatgacttgggcagaggtggcaatgaagagagtacaaagacgggaaacgcc gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system