Malassezia sympodialis: MSY001_1626 Help Entry MSY001_1626       CDS       T06541                                  Name (RefSeq) uncharacterized protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism msym  Malassezia sympodialis Pathway msym03020   RNA polymerase msym03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:msym00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MSY001_1626   09124 Replication and repair    03420 Nucleotide excision repair     MSY001_1626  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:msym03021]     MSY001_1626    03400 DNA repair and recombination proteins [BR:msym03400]     MSY001_1626 Transcription machinery [BR:msym03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MSY001_1626   RNA polymerase III system    RNA polymerase III      MSY001_1626   RNA polymerase I system    RNA polymerase I      MSY001_1626 DNA repair and recombination proteins [BR:msym03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MSY001_1626 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  30056511 NCBI-ProteinID:  XP_018740196 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDLDESGVHEEGFYSDEPEFQDGDIDDPLNEGEAGDDMEQYGDEQVVHSSAGGTVPPHKD NIGKPNEERITTPYMTKYEKARILGTRALQIRYVGTAYSRVSANACQYECACAGPYRG NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatcttgacgagtccggtgtgcacgaggagggattctacagtgatgagcctgaattc caagatggcgatattgatgacccgctgaatgagggcgaggccggagacgacatggaacaa tatggcgatgaacaggtggttcactcgagcgctggtggcacggtgcctcctcacaaggac aatattggaaagccaaatgaggagaggatcaccacgccttatatgaccaaatacgagaaa gcccgtatcctcggcacgcgcgccctgcagatcaggtatgtgggaactgcgtatagccgg gtgagtgctaacgcttgccagtatgaatgcgcctgtgctggtccctaccgagggtga

DBGET integrated database retrieval system