Myotis brandtii (Brandt's bat): 102258487 Help Entry 102258487         CDS       T02920                                  Symbol SOD1 Name (RefSeq) superoxide dismutase 1   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04146   Peroxisome myb04213   Longevity regulating pathway - multiple species myb05012   Parkinson disease myb05014   Amyotrophic lateral sclerosis myb05016   Huntington disease myb05020   Prion disease myb05022   Pathways of neurodegeneration - multiple diseases myb05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:myb00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     102258487 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     102258487 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     102258487 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     102258487 (SOD1)    05014 Amyotrophic lateral sclerosis     102258487 (SOD1)    05016 Huntington disease     102258487 (SOD1)    05020 Prion disease     102258487 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     102258487 (SOD1) Enzymes [BR:myb01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      102258487 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  102258487 NCBI-ProteinID:  XP_005860776 LinkDB All DBs Position Un AA seq 144 aa AA seqDB search MSPTWSQTCASLWIQGNGKVKVSGSIRELTEGEHGFHVHQFGDNTQGCTSAGPHFNPLSK THGGPQDEERHVGDLGNVTAGPDGVANVLIEDSVIALSGDHSIIGRTLVVHEKRDDLGKG GNDESKKTGNAGSRLACGVIGITQ NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgtccccaacatggtctcagacttgtgcttctctctggatacagggaaacgggaaggtc aaggtctcgggctccatcagagagctgacggagggcgagcacggcttccatgtccaccag tttggagataacacacaaggctgtaccagtgcaggtcctcactttaaccctctgtccaag acccatggcgggccgcaggacgaagagaggcatgtcggggacctgggcaacgtgacggcg ggcccggacggtgtggccaacgtgctcattgaggactctgtgattgcgctctcgggagac cattccatcatcggccgcacactcgtggtccacgagaagcgagatgacctgggcaaaggt gggaatgacgaaagcaagaagacgggcaacgccgggagccgcctggcctgcggggtgatc ggcatcacccagtga

DBGET integrated database retrieval system