Myotis davidii (David's myotis): 102757956 Help Entry 102757956         CDS       T02992                                  Name (RefSeq) cystatin-C   KO K13899   cystatin-C Organism myd  Myotis davidii (David's myotis) Pathway myd04970   Salivary secretion Brite KEGG Orthology (KO) [BR:myd00001]  09150 Organismal Systems   09154 Digestive system    04970 Salivary secretion     102757956  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:myd01002]     102757956   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myd04147]     102757956 Peptidases and inhibitors [BR:myd01002]  Peptidase inhibitors   Family I25: cystatin family    102757956 Exosome [BR:myd04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102757956 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  102757956 NCBI-ProteinID:  XP_006757313 UniProt:  L5MBM3 LinkDB All DBs Position Un AA seq 74 aa AA seqDB search MRVVRARKQLVAGLNYFLDVEIGRTTCTKSQPNLASCPFHVQPHLRKEALCSFQVYTVPW LGKTSLVKSSCQDA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgcgggtggtgcgcgcccgcaagcagctcgtggctgggctgaactacttcttggatgtg gaaatcggtcgaaccacatgtaccaagtcccagcccaacttggccagctgtcccttccac gtgcagccgcacctgaggaaggaagcgctctgctctttccaggtatacactgtcccctgg ttgggcaagacctccttggtgaagtccagctgccaggacgcatag

DBGET integrated database retrieval system