Neisseria brasiliensis: GJV52_07825 Help Entry GJV52_07825       CDS       T06557                                  Symbol secB Name (GenBank) protein-export chaperone SecB   KO K03071   preprotein translocase subunit SecB Organism nbl  Neisseria brasiliensis Pathway nbl02024   Quorum sensing nbl03060   Protein export nbl03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:nbl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GJV52_07825 (secB)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GJV52_07825 (secB)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GJV52_07825 (secB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:nbl03110]     GJV52_07825 (secB)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:nbl02044]     GJV52_07825 (secB) Chaperones and folding catalysts [BR:nbl03110]  Other chaperones and cochaperones   SecB    GJV52_07825 (secB) Secretion system [BR:nbl02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    GJV52_07825 (secB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecB OCD_Mu_crystall EMC7_beta-sandw Motif Other DBs NCBI-ProteinID:  QGL25442 UniProt:  A0A5Q3S0C1 LinkDB All DBs Position 1533334..1533768 Genome browser AA seq 144 aa AA seqDB search MAEELQPVFSIERLYVKDLSLEVPNAPQIFLEQGDPEVDMRVSTASQKLEEGIYAVDVTV TVTAKLNAERTMFLNEVTQSGIFRLENIPEEDTQLLLGVACPNILFPYAREAISSTVTRA GFPPVLLAPINFEAMYQQQQEGNA NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggcagaagaattgcaacctgtattcagcattgagcgtttgtatgtaaaagatttgtct ttggaagtgcctaacgcaccacaaatcttcttggagcaaggcgatcctgaagtcgatatg cgcgtgtcaaccgccagccaaaagctggaagagggcatttacgctgttgacgtaaccgtg accgttaccgctaagctgaacgcagagcgcaccatgttcctgaacgaagtgacccaaagc ggcattttccgtttggaaaatattccggaagaagacacccaattgctgttgggcgtggct tgtccgaacatcttgttcccatacgcgcgcgaagccatttcttcaaccgtgacccgtgcc ggcttcccaccggtattgttggcaccaatcaacttcgaagcgatgtaccaacaacagcaa gaaggcaatgcttaa

DBGET integrated database retrieval system