Sciurus carolinensis (gray squirrel): 124992482 Help Entry 124992482         CDS       T08117                                  Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism ncar  Sciurus carolinensis (gray squirrel) Pathway ncar04146   Peroxisome ncar04213   Longevity regulating pathway - multiple species ncar05012   Parkinson disease ncar05014   Amyotrophic lateral sclerosis ncar05016   Huntington disease ncar05020   Prion disease ncar05022   Pathways of neurodegeneration - multiple diseases ncar05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:ncar00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     124992482  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     124992482  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     124992482   09164 Neurodegenerative disease    05012 Parkinson disease     124992482    05014 Amyotrophic lateral sclerosis     124992482    05016 Huntington disease     124992482    05020 Prion disease     124992482    05022 Pathways of neurodegeneration - multiple diseases     124992482 Enzymes [BR:ncar01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      124992482 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  124992482 NCBI-ProteinID:  XP_047419224 EnsemblRapid:  ENSSCRG00010009389 LinkDB All DBs Position 9:129422230..129431176 Genome browser AA seq 152 aa AA seqDB search MATKAVCVLKGDGPVQGTIHFEQQANKVVVSGRITGLTEGQHGFHVHQFGDNTQGCTSAG PHFNPQSKKHGGPTDQERHVGDLGNVLADKDGVAIVSIEDSLISLLGEHSIIGRTMVIHE KPDDLGKGGNEESTKTGNAGSRLACGVIGIAQ NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcaacgaaggccgtgtgcgtgctgaagggcgacggcccggtgcagggcaccatccac ttcgagcagcaggcaaataaagttgtggtatcgggacgcattacaggattgactgaaggc cagcacggattccacgtccatcagtttggagataatacacaaggctgtacaagtgcaggt cctcacttcaatcctcaatccaaaaaacatggtgggccaacggatcaagaaaggcatgtt ggagacctgggcaatgtgcttgctgacaaagatggtgtggccattgtgtccattgaagat tctctgatctcactcttgggagagcattccatcattggccgcacaatggtgatccatgaa aaaccagatgacttgggcaaaggtggaaatgaagaaagtacaaagacgggaaatgctgga agtcggctggcttgtggtgtaattgggatcgcgcagtaa

DBGET integrated database retrieval system