Nocardia sp. CS682: DMB37_12690 Help Entry DMB37_12690       CDS       T06040                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism noz  Nocardia sp. CS682 Brite KEGG Orthology (KO) [BR:noz00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     DMB37_12690 Enzymes [BR:noz01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      DMB37_12690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_4 GST_N_3 NinD Glrx-like Thioredoxin Motif Other DBs NCBI-ProteinID:  QBS40846 UniProt:  A0A4V1BFQ5 LinkDB All DBs Position 2823564..2823842 Genome browser AA seq 92 aa AA seqDB search MTESGPSESTAPITIYWRRWCPYCQRLGVRLRLAGIPFRKVDITRDPAAAAEVRAITGGD EITPTVLANGHQLVNPSVDEIRAALAAPPSVS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtccggaccgtccgaaagcaccgcgccgatcaccatctactggcgtcgctgg tgcccgtactgccagcgcctaggtgtccgacttcgcctggcgggcatccctttccgcaaa gtggacatcactcgcgatccggctgccgcggccgaggtgcgggcgatcaccggcggggac gagatcacgcctaccgtgctggcgaacgggcaccaactggtgaatccgagcgtcgacgag attcgcgcagccctcgccgcacctccctcggtgtcgtaa

DBGET integrated database retrieval system