Ornithorhynchus anatinus (platypus): 100079331 Help Entry 100079331         CDS       T01045                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04010   MAPK signaling pathway oaa04014   Ras signaling pathway oaa04015   Rap1 signaling pathway oaa04024   cAMP signaling pathway oaa04062   Chemokine signaling pathway oaa04510   Focal adhesion oaa04520   Adherens junction oaa04611   Platelet activation oaa04670   Leukocyte transendothelial migration oaa04720   Long-term potentiation oaa04722   Neurotrophin signaling pathway oaa04934   Cushing syndrome oaa04972   Pancreatic secretion oaa05211   Renal cell carcinoma oaa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100079331 (RAP1B)    04014 Ras signaling pathway     100079331 (RAP1B)    04015 Rap1 signaling pathway     100079331 (RAP1B)    04024 cAMP signaling pathway     100079331 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100079331 (RAP1B)    04520 Adherens junction     100079331 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100079331 (RAP1B)    04670 Leukocyte transendothelial migration     100079331 (RAP1B)    04062 Chemokine signaling pathway     100079331 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     100079331 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     100079331 (RAP1B)    04722 Neurotrophin signaling pathway     100079331 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     100079331 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100079331 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100079331 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oaa04147]     100079331 (RAP1B)    04031 GTP-binding proteins [BR:oaa04031]     100079331 (RAP1B) Exosome [BR:oaa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100079331 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    100079331 (RAP1B)   Exosomal proteins of colorectal cancer cells    100079331 (RAP1B) GTP-binding proteins [BR:oaa04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     100079331 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  100079331 NCBI-ProteinID:  XP_001511363 Ensembl:  ENSOANG00000005936 UniProt:  F6PQC9 LinkDB All DBs Position 14:16998465..17037059 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtacaagctagttgttcttggctcaggaggcgttgggaagtcagccctgact gtgcagtttgtccaaggaatatttgttgaaaaatatgatcctacgatagaagattcgtac agaaagcaagtggaagtagatgctcaacagtgtatgcttgagattttggacacggcagga acggaacaatttacagcaatgagagacttgtacatgaaaaacggacagggctttgcatta gtgtattccatcacagcacagtccacatttaacgacttacaagatctgcgagaacagatt cttcgagttaaagataccgacgacgtgccaatgattctggttgggaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggccagaacctagcaagacaatggaacaac tgtgcgttcttagaatcctcagctaaatcaaagataaacgttaatgagatcttttatgat ctagtgcggcaaattaatagaaaaactccagtccccggaaaggcacgtaaaaagtcgtcg tgtcaactgctttaa

DBGET integrated database retrieval system