Ovis aries (sheep): 101120455 Help Entry 101120455         CDS       T03117                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism oas  Ovis aries (sheep) Pathway oas04613   Neutrophil extracellular trap formation oas05034   Alcoholism oas05203   Viral carcinogenesis oas05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oas00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101120455  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101120455   09163 Immune disease    05322 Systemic lupus erythematosus     101120455   09165 Substance dependence    05034 Alcoholism     101120455  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oas03036]     101120455   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oas04147]     101120455 Chromosome and associated proteins [BR:oas03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101120455 Exosome [BR:oas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101120455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF6246 Motif Other DBs NCBI-GeneID:  101120455 NCBI-ProteinID:  XP_004002472 UniProt:  A0A6P3DZG3 LinkDB All DBs Position 1:complement(99927399..99936847) Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcaaaatccgctcctgctcctaaaaaaggttctaagaaagctgtcacg aaagtgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctattccgtt tacgtgtataaggtgctgaaacaggtacacccggacaccggcatctcgtccaaggccatg ggcatcatgaattccttcgtcaatgacatcttcgagcgcattgccggcgaagcgtcgcgt ctggcgcattacaacaagcgctcaaccattacttctcgggagatccagacggcggtgcgc ctgctgcttcccggtgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagttcaaaatga

DBGET integrated database retrieval system