Osmia bicornis bicornis (red mason bee): 114880968 Help Entry 114880968         CDS       T06109                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism obb  Osmia bicornis bicornis (red mason bee) Brite KEGG Orthology (KO) [BR:obb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:obb03036]     114880968   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:obb04147]     114880968 Chromosome and associated proteins [BR:obb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114880968 Exosome [BR:obb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114880968 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931 Motif Other DBs NCBI-GeneID:  114880968 NCBI-ProteinID:  XP_029053360 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MPPKASGKAVKKAGKAQKNISKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM NSFVNDVFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT SSK NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgcctcctaaagcaagtggtaaggctgtgaagaaggctggcaaagctcagaagaacatc agcaaaaccgataagaagaagaagaggaagaggaaggaaagctacgcaatctacatctac aaagtgttgaagcaagtccatcctgacactggaatttccagcaaggcgatgagcattatg aacagttttgtgaatgatgtatttgagcggattgctgctgaagcctcacgcctagctcat tacaacaagagatcgaccatcacatctcgggagatccaaactgctgtcagactattgttg cctggtgaattagcgaagcatgctgtttctgaaggcaccaaagcagttacgaaatacacc agctcgaagtaa

DBGET integrated database retrieval system