Oryctolagus cuniculus (rabbit): 127485645 Help Entry 127485645         CDS       T03373                                  Name (RefSeq) thymosin beta-4   KO K05764   thymosin, beta 4 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ocu00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     127485645  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ocu04812]     127485645 Cytoskeleton proteins [BR:ocu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      127485645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin WH2 Qua1 Motif Other DBs NCBI-GeneID:  127485645 NCBI-ProteinID:  XP_051684813 LinkDB All DBs Position Unknown AA seq 44 aa AA seqDB search MADKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggccgacaagcccgacatggcggagatcgagaagttcgacaagtcgaagctgaagaag acggagacgcaagagaagaacccgctgccctcgaaagagaccatcgagcaggagaaacaa gccggcgagtcctaa

DBGET integrated database retrieval system