Oryx dammah (scimitar-horned oryx): 120854180 Help Entry 120854180         CDS       T07255                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04146   Peroxisome oda04213   Longevity regulating pathway - multiple species oda05012   Parkinson disease oda05014   Amyotrophic lateral sclerosis oda05016   Huntington disease oda05020   Prion disease oda05022   Pathways of neurodegeneration - multiple diseases oda05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:oda00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     120854180 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     120854180 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     120854180 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     120854180 (SOD1)    05014 Amyotrophic lateral sclerosis     120854180 (SOD1)    05016 Huntington disease     120854180 (SOD1)    05020 Prion disease     120854180 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     120854180 (SOD1) Enzymes [BR:oda01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      120854180 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  120854180 NCBI-ProteinID:  XP_040083900 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MATKAVCVLKGDGPVQGTIRFEAKGDKVVVTGSITGLTEGYHGFHVHQFGDNTQGCTTAG PHFNPLSKKHGGPKDEERHVGDLGNVKADENGVAIVDIVDPLISLSGEYSIIGRTMVVHE KPDDLGRGGNEESTKTGNAGSRLACGVIGIAQ NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtctgcgtgctgaagggtgacggcccggtgcaaggcaccatccgc ttcgaggcaaagggagataaagtcgtcgtaactggatccattacagggttgactgaaggt tatcatggattccacgtccatcagtttggagacaatacacaaggctgtaccactgcaggt ccgcactttaatcctctgtccaaaaaacatggtgggccaaaagatgaagagaggcatgtt ggagacctgggcaatgtgaaggctgacgaaaacggtgttgccattgtggatattgtagat cctttgatctcactctcaggagaatattccatcattggccgcacgatggtggtccatgaa aaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagactgggaacgctgga agtcgtttggcctgtggtgtaattggaattgcccagtaa

DBGET integrated database retrieval system