Oryx dammah (scimitar-horned oryx): 120875083 Help Entry 120875083         CDS       T07255                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04024   cAMP signaling pathway oda04062   Chemokine signaling pathway oda04064   NF-kappa B signaling pathway oda04210   Apoptosis oda04380   Osteoclast differentiation oda04620   Toll-like receptor signaling pathway oda04621   NOD-like receptor signaling pathway oda04622   RIG-I-like receptor signaling pathway oda04623   Cytosolic DNA-sensing pathway oda04625   C-type lectin receptor signaling pathway oda04657   IL-17 signaling pathway oda04658   Th1 and Th2 cell differentiation oda04659   Th17 cell differentiation oda04660   T cell receptor signaling pathway oda04662   B cell receptor signaling pathway oda04668   TNF signaling pathway oda04722   Neurotrophin signaling pathway oda04920   Adipocytokine signaling pathway oda04926   Relaxin signaling pathway oda04931   Insulin resistance oda04936   Alcoholic liver disease oda05132   Salmonella infection oda05134   Legionellosis oda05135   Yersinia infection oda05140   Leishmaniasis oda05142   Chagas disease oda05145   Toxoplasmosis oda05160   Hepatitis C oda05161   Hepatitis B oda05162   Measles oda05163   Human cytomegalovirus infection oda05164   Influenza A oda05166   Human T-cell leukemia virus 1 infection oda05167   Kaposi sarcoma-associated herpesvirus infection oda05168   Herpes simplex virus 1 infection oda05169   Epstein-Barr virus infection oda05170   Human immunodeficiency virus 1 infection oda05171   Coronavirus disease - COVID-19 oda05200   Pathways in cancer oda05203   Viral carcinogenesis oda05208   Chemical carcinogenesis - reactive oxygen species oda05215   Prostate cancer oda05220   Chronic myeloid leukemia oda05222   Small cell lung cancer oda05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oda05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     120875083 (NFKBIA)    04668 TNF signaling pathway     120875083 (NFKBIA)    04024 cAMP signaling pathway     120875083 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     120875083 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120875083 (NFKBIA)    04621 NOD-like receptor signaling pathway     120875083 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     120875083 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     120875083 (NFKBIA)    04625 C-type lectin receptor signaling pathway     120875083 (NFKBIA)    04660 T cell receptor signaling pathway     120875083 (NFKBIA)    04658 Th1 and Th2 cell differentiation     120875083 (NFKBIA)    04659 Th17 cell differentiation     120875083 (NFKBIA)    04657 IL-17 signaling pathway     120875083 (NFKBIA)    04662 B cell receptor signaling pathway     120875083 (NFKBIA)    04062 Chemokine signaling pathway     120875083 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     120875083 (NFKBIA)    04926 Relaxin signaling pathway     120875083 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     120875083 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     120875083 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120875083 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     120875083 (NFKBIA)    05203 Viral carcinogenesis     120875083 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120875083 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     120875083 (NFKBIA)    05215 Prostate cancer     120875083 (NFKBIA)    05222 Small cell lung cancer     120875083 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120875083 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     120875083 (NFKBIA)    05161 Hepatitis B     120875083 (NFKBIA)    05160 Hepatitis C     120875083 (NFKBIA)    05171 Coronavirus disease - COVID-19     120875083 (NFKBIA)    05164 Influenza A     120875083 (NFKBIA)    05162 Measles     120875083 (NFKBIA)    05168 Herpes simplex virus 1 infection     120875083 (NFKBIA)    05163 Human cytomegalovirus infection     120875083 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     120875083 (NFKBIA)    05169 Epstein-Barr virus infection     120875083 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     120875083 (NFKBIA)    05135 Yersinia infection     120875083 (NFKBIA)    05134 Legionellosis     120875083 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     120875083 (NFKBIA)    05140 Leishmaniasis     120875083 (NFKBIA)    05142 Chagas disease     120875083 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120875083 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120875083 (NFKBIA)    04931 Insulin resistance     120875083 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oda03000]     120875083 (NFKBIA)    04131 Membrane trafficking [BR:oda04131]     120875083 (NFKBIA) Transcription factors [BR:oda03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     120875083 (NFKBIA) Membrane trafficking [BR:oda04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     120875083 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 Motif Other DBs NCBI-GeneID:  120875083 NCBI-ProteinID:  XP_040112689 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctcgactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcgctcaccatggaagtggtccgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc actaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggctagtgtg ggagtcctgactcagccccggggaacccagcacctccactccatcctgcaggccaccaac tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggtgctgatgtcaatgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctattgaagtgtggg gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacatggggccgc cccagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagacactg ccagagagcgaggatgaggagagctatgacaccgaatcagagttcacagaggacgagctt ccttacgatgactgtgtgcttggaggccagcgcctgacattatga

DBGET integrated database retrieval system