Ostrinia furnacalis (Asian corn borer): 114360995 Help Entry 114360995         CDS       T07986                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism ofu  Ostrinia furnacalis (Asian corn borer) Brite KEGG Orthology (KO) [BR:ofu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ofu03036]     114360995   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ofu04147]     114360995 Chromosome and associated proteins [BR:ofu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114360995 Exosome [BR:ofu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114360995 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  114360995 NCBI-ProteinID:  XP_028171694 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MPPKTSGKAAKKSGKAQKNISKTDKKKKKHKRKESYAIYIYKVLKQVHPDTGISSKAMSI MNSFVNDIFERIAAEASRLAHYNXSNIF NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgccgcccaagacaagtggcaaggccgccaagaagtcaggcaaggctcagaagaacatc tccaaaactgacaagaagaagaagaagcacaagaggaaggagagctacgccatctacatc tacaaagtgctgaagcaggtccaccccgacaccggtatctccagcaaggccatgtcgatc atgaactcgttcgtgaacgacatcttcgaacgcatcgccgccgaagcttcccgtctggct cactacaacntgtccaatattttttga

DBGET integrated database retrieval system