Otolemur garnettii (small-eared galago): 100948748 Help Entry 100948748         CDS       T07855                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04146   Peroxisome oga04213   Longevity regulating pathway - multiple species oga05012   Parkinson disease oga05014   Amyotrophic lateral sclerosis oga05016   Huntington disease oga05020   Prion disease oga05022   Pathways of neurodegeneration - multiple diseases oga05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:oga00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     100948748 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     100948748 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     100948748 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     100948748 (SOD1)    05014 Amyotrophic lateral sclerosis     100948748 (SOD1)    05016 Huntington disease     100948748 (SOD1)    05020 Prion disease     100948748 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     100948748 (SOD1) Enzymes [BR:oga01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      100948748 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  100948748 NCBI-ProteinID:  XP_003797119 Ensembl:  ENSOGAG00000014646 UniProt:  H0XBM9 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTMKAVCVLKGDGAVQGTIHFEQQGNGPVMVKGRITGLAEGDHGFHVHQFGDNTQGCTSA GPHFNPQSKKHGGPKDEERHVGDLGNVTAGKNGEAIVSIEDSMISLSGEHSIIGRTMVVH EKADDLGKGGNEESTKTGNAGGRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacgatgaaggcggtgtgcgtgttgaagggtgacggcgcagtgcagggcaccatccac ttcgagcagcagggaaatggaccagttatggtaaagggacgcattacaggactggctgaa ggtgatcacggattccatgtccatcagtttggagataatacacaaggctgtaccagtgca ggtcctcactttaatcctcaatccaaaaaacatggtgggccaaaggatgaagagaggcat gttggagatctgggcaatgtgactgccggcaaaaatggtgaggccattgtgtctattgaa gattctatgatctcactctcaggagaacattccatcattggccgcacaatggtggtccac gaaaaagcagatgacttgggcaaaggtggaaatgaagaaagtacaaagacgggaaatgct ggaggtcgactggcttgtggcgtaattgggatcgcccagtaa

DBGET integrated database retrieval system