Otolemur garnettii (small-eared galago): 100952744 Help Entry 100952744         CDS       T07855                                  Name (RefSeq) cytochrome c, somatic   KO K08738   cytochrome c Organism oga  Otolemur garnettii (small-eared galago) Pathway oga00190   Oxidative phosphorylation oga01100   Metabolic pathways oga01524   Platinum drug resistance oga04115   p53 signaling pathway oga04210   Apoptosis oga04215   Apoptosis - multiple species oga04932   Non-alcoholic fatty liver disease oga05010   Alzheimer disease oga05012   Parkinson disease oga05014   Amyotrophic lateral sclerosis oga05016   Huntington disease oga05017   Spinocerebellar ataxia oga05020   Prion disease oga05022   Pathways of neurodegeneration - multiple diseases oga05132   Salmonella infection oga05134   Legionellosis oga05145   Toxoplasmosis oga05152   Tuberculosis oga05160   Hepatitis C oga05161   Hepatitis B oga05162   Measles oga05163   Human cytomegalovirus infection oga05164   Influenza A oga05167   Kaposi sarcoma-associated herpesvirus infection oga05168   Herpes simplex virus 1 infection oga05169   Epstein-Barr virus infection oga05170   Human immunodeficiency virus 1 infection oga05200   Pathways in cancer oga05210   Colorectal cancer oga05222   Small cell lung cancer oga05416   Viral myocarditis oga05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100952744  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100952744    04215 Apoptosis - multiple species     100952744    04115 p53 signaling pathway     100952744  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100952744   09162 Cancer: specific types    05210 Colorectal cancer     100952744    05222 Small cell lung cancer     100952744   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100952744    05161 Hepatitis B     100952744    05160 Hepatitis C     100952744    05164 Influenza A     100952744    05162 Measles     100952744    05168 Herpes simplex virus 1 infection     100952744    05163 Human cytomegalovirus infection     100952744    05167 Kaposi sarcoma-associated herpesvirus infection     100952744    05169 Epstein-Barr virus infection     100952744   09171 Infectious disease: bacterial    05132 Salmonella infection     100952744    05134 Legionellosis     100952744    05152 Tuberculosis     100952744   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100952744   09164 Neurodegenerative disease    05010 Alzheimer disease     100952744    05012 Parkinson disease     100952744    05014 Amyotrophic lateral sclerosis     100952744    05016 Huntington disease     100952744    05017 Spinocerebellar ataxia     100952744    05020 Prion disease     100952744    05022 Pathways of neurodegeneration - multiple diseases     100952744   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100952744    05416 Viral myocarditis     100952744   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100952744   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100952744 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100952744 NCBI-ProteinID:  XP_012663028 Ensembl:  ENSOGAG00000030025 UniProt:  G4XXS4 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaaaggaggcaagcacaaaactgggccaaatctccatggcctctttgggaggaag acaggtcaggctgctggcttctcttacacagatgccaataagaacaaaggcataacctgg ggagaggacacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagaagggagaaagggcagacttgatagcttatctcaaa aaagctacaaatgagtaa

DBGET integrated database retrieval system