Otolemur garnettii (small-eared galago): 100955379 Help Entry 100955379         CDS       T07855                                  Symbol IL5 Name (RefSeq) interleukin-5 isoform X1   KO K05428   interleukin 5 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04060   Cytokine-cytokine receptor interaction oga04630   JAK-STAT signaling pathway oga04640   Hematopoietic cell lineage oga04657   IL-17 signaling pathway oga04658   Th1 and Th2 cell differentiation oga04660   T cell receptor signaling pathway oga04664   Fc epsilon RI signaling pathway oga04672   Intestinal immune network for IgA production oga05200   Pathways in cancer oga05310   Asthma oga05320   Autoimmune thyroid disease oga05321   Inflammatory bowel disease oga05330   Allograft rejection Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100955379 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100955379 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100955379 (IL5)    04660 T cell receptor signaling pathway     100955379 (IL5)    04658 Th1 and Th2 cell differentiation     100955379 (IL5)    04657 IL-17 signaling pathway     100955379 (IL5)    04664 Fc epsilon RI signaling pathway     100955379 (IL5)    04672 Intestinal immune network for IgA production     100955379 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100955379 (IL5)   09163 Immune disease    05310 Asthma     100955379 (IL5)    05320 Autoimmune thyroid disease     100955379 (IL5)    05321 Inflammatory bowel disease     100955379 (IL5)    05330 Allograft rejection     100955379 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     100955379 (IL5)    00536 Glycosaminoglycan binding proteins [BR:oga00536]     100955379 (IL5) Cytokines and neuropeptides [BR:oga04052]  Cytokines   Interleukins    100955379 (IL5) Glycosaminoglycan binding proteins [BR:oga00536]  Heparan sulfate / Heparin   Cytokines    100955379 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  100955379 NCBI-ProteinID:  XP_003782257 Ensembl:  ENSOGAG00000015494 UniProt:  B5FW65 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRMLLRLSLLALGAACVCAIPIEISMSTLVKETLALLSTHQTLLIHNETLRIPVPVHKNH QLCTEEIFHGLDTLRNQTAHEDGVEQLFQNLSLIKKYIDRQKKRCGEERRKVKQFLDYLQ EFLGIINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgaggatgcttctgcgtttgagtttgctggctcttggagctgcctgcgtttgtgccatt cccatcgaaatttccatgagtacactggtgaaagagaccttggcgctgctttccactcat caaactctgctgatacacaatgagaccctgaggattcctgttcctgtccataaaaatcac caactttgtactgaagaaatctttcatggactggacacactgaggaatcaaactgcacat gaggatggtgtggaacaactattccaaaacttgtctttaattaaaaagtacattgaccgc cagaaaaaaaggtgtggagaagaaagacggaaagtaaagcaattcctcgattacctgcag gagtttcttggcataataaatactgagtggacaatggaaagttga

DBGET integrated database retrieval system