Otolemur garnettii (small-eared galago): 100963622 Help Entry 100963622         CDS       T07855                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga01522   Endocrine resistance oga01524   Platinum drug resistance oga04010   MAPK signaling pathway oga04071   Sphingolipid signaling pathway oga04110   Cell cycle oga04115   p53 signaling pathway oga04137   Mitophagy - animal oga04151   PI3K-Akt signaling pathway oga04210   Apoptosis oga04211   Longevity regulating pathway oga04216   Ferroptosis oga04218   Cellular senescence oga04310   Wnt signaling pathway oga04722   Neurotrophin signaling pathway oga04919   Thyroid hormone signaling pathway oga05012   Parkinson disease oga05014   Amyotrophic lateral sclerosis oga05016   Huntington disease oga05160   Hepatitis C oga05161   Hepatitis B oga05162   Measles oga05163   Human cytomegalovirus infection oga05165   Human papillomavirus infection oga05166   Human T-cell leukemia virus 1 infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05168   Herpes simplex virus 1 infection oga05169   Epstein-Barr virus infection oga05200   Pathways in cancer oga05202   Transcriptional misregulation in cancer oga05203   Viral carcinogenesis oga05205   Proteoglycans in cancer oga05206   MicroRNAs in cancer oga05210   Colorectal cancer oga05212   Pancreatic cancer oga05213   Endometrial cancer oga05214   Glioma oga05215   Prostate cancer oga05216   Thyroid cancer oga05217   Basal cell carcinoma oga05218   Melanoma oga05219   Bladder cancer oga05220   Chronic myeloid leukemia oga05222   Small cell lung cancer oga05223   Non-small cell lung cancer oga05224   Breast cancer oga05225   Hepatocellular carcinoma oga05226   Gastric cancer oga05230   Central carbon metabolism in cancer oga05417   Lipid and atherosclerosis oga05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100963622 (TP53)    04310 Wnt signaling pathway     100963622 (TP53)    04071 Sphingolipid signaling pathway     100963622 (TP53)    04151 PI3K-Akt signaling pathway     100963622 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100963622 (TP53)   09143 Cell growth and death    04110 Cell cycle     100963622 (TP53)    04210 Apoptosis     100963622 (TP53)    04216 Ferroptosis     100963622 (TP53)    04115 p53 signaling pathway     100963622 (TP53)    04218 Cellular senescence     100963622 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     100963622 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     100963622 (TP53)   09149 Aging    04211 Longevity regulating pathway     100963622 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100963622 (TP53)    05202 Transcriptional misregulation in cancer     100963622 (TP53)    05206 MicroRNAs in cancer     100963622 (TP53)    05205 Proteoglycans in cancer     100963622 (TP53)    05203 Viral carcinogenesis     100963622 (TP53)    05230 Central carbon metabolism in cancer     100963622 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     100963622 (TP53)    05212 Pancreatic cancer     100963622 (TP53)    05225 Hepatocellular carcinoma     100963622 (TP53)    05226 Gastric cancer     100963622 (TP53)    05214 Glioma     100963622 (TP53)    05216 Thyroid cancer     100963622 (TP53)    05220 Chronic myeloid leukemia     100963622 (TP53)    05217 Basal cell carcinoma     100963622 (TP53)    05218 Melanoma     100963622 (TP53)    05219 Bladder cancer     100963622 (TP53)    05215 Prostate cancer     100963622 (TP53)    05213 Endometrial cancer     100963622 (TP53)    05224 Breast cancer     100963622 (TP53)    05222 Small cell lung cancer     100963622 (TP53)    05223 Non-small cell lung cancer     100963622 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100963622 (TP53)    05161 Hepatitis B     100963622 (TP53)    05160 Hepatitis C     100963622 (TP53)    05162 Measles     100963622 (TP53)    05168 Herpes simplex virus 1 infection     100963622 (TP53)    05163 Human cytomegalovirus infection     100963622 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     100963622 (TP53)    05169 Epstein-Barr virus infection     100963622 (TP53)    05165 Human papillomavirus infection     100963622 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     100963622 (TP53)    05014 Amyotrophic lateral sclerosis     100963622 (TP53)    05016 Huntington disease     100963622 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100963622 (TP53)    05418 Fluid shear stress and atherosclerosis     100963622 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100963622 (TP53)    01522 Endocrine resistance     100963622 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oga03000]     100963622 (TP53)    03036 Chromosome and associated proteins [BR:oga03036]     100963622 (TP53)    03400 DNA repair and recombination proteins [BR:oga03400]     100963622 (TP53) Transcription factors [BR:oga03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     100963622 (TP53) Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      100963622 (TP53) DNA repair and recombination proteins [BR:oga03400]  Eukaryotic type   Check point factors    Other check point factors     100963622 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD TAD2 Motif Other DBs NCBI-GeneID:  100963622 NCBI-ProteinID:  XP_012661495 Ensembl:  ENSOGAG00000016871 LinkDB All DBs Position Unknown AA seq 390 aa AA seqDB search MEETQSDLTIEPPLSQETFSDLWKLLPENNVLSSSLSPPVDDLMLSPDIVNWFDEGPDEA LRTLEDPAPVASTTAALTPAASAPVTGWPLSSCVPSQTTYPGSYGFRLGFLNSGTAKSVT CTYSPVLNKMFCQLAKTCPVQLWFDSTPPPGSRIRAMAIYKQSQHMTEVVRRCPHHERCS ESDGLAPPQHLIRVEGNLRVEYLDDKNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCM GGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENSRKKGETCSEPSLGS TKRSLPTSTSSSPQPKKKLLEGEYFTLKIRGRERYEMFRELNEALEIKDAQAEKESDGNR AHSSQPKSKKEQSTSRHKKLMFKREGPDSD NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt atggaggagacacaatcggacctcaccattgagccccctctgagtcaagagacattttca gacttatggaaactacttcctgaaaacaatgttctgtcctcctcactgtccccaccagtg gatgatctgatgctgtccccagacattgtaaactggtttgatgaaggtccagatgaagcg ctcagaacgttagaggatcctgcaccagtggcttccacaacagctgcccttacaccagca gcctctgcaccagtcaccggctggcctctgtcatcctgtgtcccttctcagacaacttac cctggcagctacggtttccgcctcggcttcttgaattctggcacagccaagtctgtcacc tgcacgtattctcctgtcctgaacaagatgttttgccagctggcgaagacctgccctgta cagctgtggttcgactccacacccccaccaggcagtcgcatccgtgccatggccatctat aagcaatcacaacacatgacagaagtggtgaggcgctgcccccaccatgagcgctgctca gaaagtgatggtctggcccctcctcagcatctcatccgggtggaaggaaatttgcgtgtg gagtatttggatgataaaaacacttttcgacacagtgtggtggtgccctatgaacctcct gaggtcggctctgactgtaccaccatccactacaactacatgtgtaacagttcctgcatg gggggcatgaaccgtcgacccatcctcaccatcatcacactggaagactctagtggtaac ctgctgggacggaacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccgccgc acagaggaagaaaattcccgcaagaaaggggagacttgttctgagccatcccttgggagc accaagcgatcactgcccaccagtaccagctcctctccacagccaaagaagaaactgctg gaaggagaatattttaccctcaagattcgcgggcgtgaacgttatgaaatgttccgagag ctgaatgaggccctggaaatcaaggatgcccaggctgagaaggagtcagatgggaacagg gctcattccagccaaccgaagtccaagaaggagcaatctacctcccgtcataaaaaatta atgttcaagagagagggacctgactccgactga

DBGET integrated database retrieval system