Horticoccus luteus: K0B96_13975 Help Entry K0B96_13975       CDS       T07405                                  Name (GenBank) glutaredoxin family protein   KO K03676   glutaredoxin 3 Organism ole  Horticoccus luteus Brite KEGG Orthology (KO) [BR:ole00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ole03110]     K0B96_13975 Chaperones and folding catalysts [BR:ole03110]  Protein folding catalysts   Protein disulfide isomerase    K0B96_13975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 GST_N Glrx-like SH3BGR Motif Other DBs NCBI-ProteinID:  QYM78394 UniProt:  A0A8F9TV84 LinkDB All DBs Position complement(3444416..3444679) Genome browser AA seq 87 aa AA seqDB search MSADYPILYVKAGCPWCHEAVSFLDEHGVSYREVDVSADQGAFDELRRKSGQTKAPTLDW HGDVLADFGVEELVPFLQKHDVKLEDN NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagtgccgattaccctattctctacgtgaaggcgggctgtccttggtgccacgaagcg gtgtcgtttctggacgagcacggcgtgagctaccgtgaggtggacgtgtcggcggaccaa ggcgcgtttgacgagctgcggcgcaagtccggccagacgaaggcgccgacgctggactgg cacggcgacgtgctggcggattttggcgtggaggaactggtgccgtttttgcagaagcac gacgtcaagttggaggacaactga

DBGET integrated database retrieval system