Oncorhynchus mykiss (rainbow trout): 110489525 Help Entry 110489525         CDS       T07259                                  Name (RefSeq) elongin-C isoform X1   KO K03872   elongin-C Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:omy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110489525  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:omy04121]     110489525    03400 DNA repair and recombination proteins [BR:omy03400]     110489525 Ubiquitin system [BR:omy04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      110489525    Cul5 complex      110489525 DNA repair and recombination proteins [BR:omy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110489525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  110489525 NCBI-ProteinID:  XP_036801564 Ensembl:  ENSOMYG00000017295 LinkDB All DBs Position 15:4465748..4468522 Genome browser AA seq 132 aa AA seqDB search MLSGPGKPLTSGTIQAMLSGPGKPLTSGTIQAMLSGPGKPLTSGTIKAMLSGPGKPLTSG TIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIA LELLMAANFLDC NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgttgagtggaccaggtaagcccttgacttcagggaccatccaagccatgttgagtgga ccaggtaagcccttgacttcagggaccatccaagctatgttgagtggaccaggtaagccc ttgacttcagggaccatcaaagccatgttgagtggaccaggtaagcccttgacttcaggg accatcaaagccatgttgagtggaccaggtcagtttgcagagaatgaaaccaacgaagtg aacttcagagagatcccctcccatgtcctgtccaaggtgtgcatgtacttcacctacaag gtccgctacaccaacagctccacggaaatcccagagttccccatcgcccctgagatcgcc ctggaactactcatggctgcaaacttcttggattgttaa

DBGET integrated database retrieval system