Orcinus orca (killer whale): 101280711 Help Entry 101280711         CDS       T05247                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism oor  Orcinus orca (killer whale) Pathway oor04146   Peroxisome oor04213   Longevity regulating pathway - multiple species oor05012   Parkinson disease oor05014   Amyotrophic lateral sclerosis oor05016   Huntington disease oor05020   Prion disease oor05022   Pathways of neurodegeneration - multiple diseases oor05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:oor00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     101280711 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     101280711 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     101280711 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     101280711 (SOD1)    05014 Amyotrophic lateral sclerosis     101280711 (SOD1)    05016 Huntington disease     101280711 (SOD1)    05020 Prion disease     101280711 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     101280711 (SOD1) Enzymes [BR:oor01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      101280711 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  101280711 NCBI-ProteinID:  XP_004264558 LinkDB All DBs Position 5:136111088..136118721 Genome browser AA seq 153 aa AA seqDB search MVTKAVCVLKGDGPVQGTIHFEQKEDGTVVVSGSITGLTEGDHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPEDEERHVGDLGNVKADQNGVAEVRIEDSVISLCGDHSIIGRTMVVH EKPDDLGRGGNEESTKTGNAGSRLACGVIGIAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggtgacgaaggccgtatgcgtgctgaagggcgacggcccggtgcagggtactatccac ttcgaacaaaaggaagatgggacggtcgtggtatcgggatccattacaggattgactgaa ggcgatcatggattccatgtccatcaatttggagataatacacaaggctgtaccagtgca ggtcctcactttaaccctctatccaaaaaacacggtgggccagaggatgaagagaggcat gttggagacctgggcaatgtgaaggctgaccagaatggtgtggccgaagtgcgtattgaa gattccgtaatctcactctgtggagaccattccatcattggccgcacaatggtggtccat gaaaaaccagatgacttgggcagaggtggaaatgaagaaagtacaaagacagggaacgct ggaagtcgtttggcctgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system