Orcinus orca (killer whale): 101283052 Help Entry 101283052         CDS       T05247                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism oor  Orcinus orca (killer whale) Pathway oor00190   Oxidative phosphorylation oor01100   Metabolic pathways oor01524   Platinum drug resistance oor04115   p53 signaling pathway oor04210   Apoptosis oor04215   Apoptosis - multiple species oor04932   Non-alcoholic fatty liver disease oor05010   Alzheimer disease oor05012   Parkinson disease oor05014   Amyotrophic lateral sclerosis oor05016   Huntington disease oor05017   Spinocerebellar ataxia oor05020   Prion disease oor05022   Pathways of neurodegeneration - multiple diseases oor05132   Salmonella infection oor05134   Legionellosis oor05145   Toxoplasmosis oor05152   Tuberculosis oor05160   Hepatitis C oor05161   Hepatitis B oor05162   Measles oor05163   Human cytomegalovirus infection oor05164   Influenza A oor05167   Kaposi sarcoma-associated herpesvirus infection oor05168   Herpes simplex virus 1 infection oor05169   Epstein-Barr virus infection oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05210   Colorectal cancer oor05222   Small cell lung cancer oor05416   Viral myocarditis oor05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     101283052  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101283052    04215 Apoptosis - multiple species     101283052    04115 p53 signaling pathway     101283052  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101283052   09162 Cancer: specific types    05210 Colorectal cancer     101283052    05222 Small cell lung cancer     101283052   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101283052    05161 Hepatitis B     101283052    05160 Hepatitis C     101283052    05164 Influenza A     101283052    05162 Measles     101283052    05168 Herpes simplex virus 1 infection     101283052    05163 Human cytomegalovirus infection     101283052    05167 Kaposi sarcoma-associated herpesvirus infection     101283052    05169 Epstein-Barr virus infection     101283052   09171 Infectious disease: bacterial    05132 Salmonella infection     101283052    05134 Legionellosis     101283052    05152 Tuberculosis     101283052   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101283052   09164 Neurodegenerative disease    05010 Alzheimer disease     101283052    05012 Parkinson disease     101283052    05014 Amyotrophic lateral sclerosis     101283052    05016 Huntington disease     101283052    05017 Spinocerebellar ataxia     101283052    05020 Prion disease     101283052    05022 Pathways of neurodegeneration - multiple diseases     101283052   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101283052    05416 Viral myocarditis     101283052   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101283052   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     101283052 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  101283052 NCBI-ProteinID:  XP_004265696 LinkDB All DBs Position 9:50425312..50428133 Genome browser AA seq 105 aa AA seqDB search MGDIEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGIKKKSERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatattgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag acaggtcaggctgtcggattctcttacacagatgccaacaagaacaaaggcatcacctgg ggagaggagacgctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagaagtcagaaagggcagacttgatagcttatctcaaa aaagctactaatgagtaa

DBGET integrated database retrieval system