Papio anubis (olive baboon): 103877032 Help Entry 103877032         CDS       T07474                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism panu  Papio anubis (olive baboon) Pathway panu04010   MAPK signaling pathway panu04020   Calcium signaling pathway panu04022   cGMP-PKG signaling pathway panu04114   Oocyte meiosis panu04218   Cellular senescence panu04310   Wnt signaling pathway panu04360   Axon guidance panu04370   VEGF signaling pathway panu04380   Osteoclast differentiation panu04625   C-type lectin receptor signaling pathway panu04650   Natural killer cell mediated cytotoxicity panu04658   Th1 and Th2 cell differentiation panu04659   Th17 cell differentiation panu04660   T cell receptor signaling pathway panu04662   B cell receptor signaling pathway panu04720   Long-term potentiation panu04724   Glutamatergic synapse panu04921   Oxytocin signaling pathway panu04922   Glucagon signaling pathway panu04924   Renin secretion panu05010   Alzheimer disease panu05014   Amyotrophic lateral sclerosis panu05020   Prion disease panu05022   Pathways of neurodegeneration - multiple diseases panu05031   Amphetamine addiction panu05152   Tuberculosis panu05163   Human cytomegalovirus infection panu05166   Human T-cell leukemia virus 1 infection panu05167   Kaposi sarcoma-associated herpesvirus infection panu05170   Human immunodeficiency virus 1 infection panu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer panu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103877032 (PPP3R1)    04310 Wnt signaling pathway     103877032 (PPP3R1)    04370 VEGF signaling pathway     103877032 (PPP3R1)    04020 Calcium signaling pathway     103877032 (PPP3R1)    04022 cGMP-PKG signaling pathway     103877032 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103877032 (PPP3R1)    04218 Cellular senescence     103877032 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103877032 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     103877032 (PPP3R1)    04660 T cell receptor signaling pathway     103877032 (PPP3R1)    04658 Th1 and Th2 cell differentiation     103877032 (PPP3R1)    04659 Th17 cell differentiation     103877032 (PPP3R1)    04662 B cell receptor signaling pathway     103877032 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     103877032 (PPP3R1)    04921 Oxytocin signaling pathway     103877032 (PPP3R1)    04924 Renin secretion     103877032 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     103877032 (PPP3R1)    04720 Long-term potentiation     103877032 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     103877032 (PPP3R1)    04380 Osteoclast differentiation     103877032 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103877032 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103877032 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     103877032 (PPP3R1)    05163 Human cytomegalovirus infection     103877032 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     103877032 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     103877032 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     103877032 (PPP3R1)    05014 Amyotrophic lateral sclerosis     103877032 (PPP3R1)    05020 Prion disease     103877032 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     103877032 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     103877032 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103877032 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:panu01009]     103877032 (PPP3R1) Protein phosphatases and associated proteins [BR:panu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103877032 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  103877032 NCBI-ProteinID:  XP_031511097 Ensembl:  ENSPANG00000024026 LinkDB All DBs Position 14:complement(68545909..68619291) Genome browser AA seq 240 aa AA seqDB search MWQMALYIRPTFSPELLLLPLTPYFPAESLGREPCHSLLSCERRFSCRAQPCGVSFRCCF PRCPGEPERSKGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ QNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNG ELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 723 nt NT seq  +upstreamnt  +downstreamnt atgtggcaaatggcgctttacataagacccactttctctccagagctgctgcttctccca ctcactccctatttcccagcagagagtcttggcagggaaccctgccactcacttctctcc tgcgagcgtcggtttagctgccgtgcgcagccttgcggggtttcctttcgttgctgcttt cctcgctgccctggcgaaccggaaagatccaagggaaatgaggcaagttatcctttggaa atgtgctcacactttgatgcggatgaaattaaaaggctaggaaagagatttaagaagctt gatttggacaattctggttctttgagtgtggaagagttcatgtctctgcctgagttacaa cagaatcctttagtacagcgagtaatagatatattcgacacagatgggaatggagaagta gactttaaagaattcattgagggcgtctctcagttcagtgtcaaaggagataaggagcag aagttgaggtttgctttccgtatctatgacatggataaagatggctatatttccaatggg gaactcttccaggtattgaagatgatggtggggaacaatctgaaagatacacagttacag caaattgtagacaaaaccataataaatgcagataaggatggagatggaagaatatccttt gaagaattctgtgctgttgtaggtggcctagatatccacaaaaagatggtggtagatgtg tga

DBGET integrated database retrieval system