Paracoccus sp. Arc7-R13: EOJ32_01890 Help Entry EOJ32_01890       CDS       T06050                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism parr  Paracoccus sp. Arc7-R13 Brite KEGG Orthology (KO) [BR:parr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:parr03036]     EOJ32_01890    03400 DNA repair and recombination proteins [BR:parr03400]     EOJ32_01890 Chromosome and associated proteins [BR:parr03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     EOJ32_01890 DNA repair and recombination proteins [BR:parr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       EOJ32_01890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS K-box DUF1744 ABATE Motif Other DBs NCBI-ProteinID:  AZY92548 UniProt:  A0A3T0PY14 LinkDB All DBs Position complement(381511..381822) Genome browser AA seq 103 aa AA seqDB search MSIDFDTMSLKEMRDLRTKLDRAINSYEDRKRREALTAIEEAAREHGFNLSELTGAKTRK SGTVAPKYANPQDPTMTWTGRGRKPRWVQECLESGKELDDLLI NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgagcatcgatttcgacactatgtccctcaaggaaatgcgcgacctgcggaccaagctg gatcgcgcgatcaactcctatgaggaccgcaagcggcgcgaagccctgacggccatcgag gaagccgcgcgcgagcatggcttcaacctgtccgagctgaccggcgccaagacgcgcaag tccgggaccgtcgccccgaaatacgccaacccgcaggacccgacgatgacctggacgggt cgcggccgcaaaccgcgttgggtgcaggaatgcctggaaagcggcaaggagctggacgat ctgctgatctga

DBGET integrated database retrieval system