Python bivittatus (Burmese python): 103048708 Help Entry 103048708         CDS       T03091                                  Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism pbi  Python bivittatus (Burmese python) Pathway pbi03082   ATP-dependent chromatin remodeling pbi04217   Necroptosis Brite KEGG Orthology (KO) [BR:pbi00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103048708  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103048708  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbi03036]     103048708   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbi04147]     103048708 Chromosome and associated proteins [BR:pbi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103048708 Exosome [BR:pbi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103048708 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  103048708 NCBI-ProteinID:  XP_007435067 UniProt:  A0A9F2R3F5 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MAGGKAGKDSGKTKTKTVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggagggaaagctgggaaggactctggaaagacgaagaccaagacggtgtctcgt tcacaaagagccggtttacagtttcctgttggtcgtattcaccggcacctgaaatcaagg acgaccagtcatgggcgtgtgggagctacagctgctgtgtatagtgctgctatcttagag tacctcacagctgaggttcttgagctagcagggaatgcatctaaagatttaaaggtaaag cgaattactcctcgtcacctgcagcttgcaataagaggtgatgaagaactggattcatta atcaaggcaacaattgctggtggaggtgtaattccacatattcataaatctctcattgga aaaaaaggtcaacaaaaaacagtttaa

DBGET integrated database retrieval system