Python bivittatus (Burmese python): 103049236 Help Entry 103049236         CDS       T03091                                  Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism pbi  Python bivittatus (Burmese python) Pathway pbi03082   ATP-dependent chromatin remodeling pbi04217   Necroptosis Brite KEGG Orthology (KO) [BR:pbi00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103049236  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103049236  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbi03036]     103049236   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbi04147]     103049236 Chromosome and associated proteins [BR:pbi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103049236 Exosome [BR:pbi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103049236 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  103049236 NCBI-ProteinID:  XP_007427780 UniProt:  A0A9F2PN54 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKPKGK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggcaagcaggggggaaaagctagagctaaggccaagtcccgctcgtct cgtgctgggctccagttccccgtaggtcgagttcaccgccttctccgtaagggaaactac gccgagcgggttggtgctggagcccccgtttaccttgctgcagtgttggagtatctgaca gctgaaattctggagctggctgggaacgcggcccgggataacaagaaaactagaataatc cctcgccacctccagttggccgtccgcaacgacgaggagctcaacaagctcttgggaggc gttactattgcccagggaggagtcttgcccaatatccaagccgtcctactaccgaagaag accgagagccacaagcccaaaggcaaatga

DBGET integrated database retrieval system